SAB1402258

Monoclonal Anti-MAG antibody produced in mouse

clone 3C7, purified immunoglobulin, buffered aqueous solution

• MDL number: MFCD02096847
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3C7, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~36.01 kDa
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• NCBI 수납 번호: NM_002361
• UniProt 수납 번호: P20916
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MAG(4099)

설명

일반 설명

The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Two alternatively spliced transcripts encoding different isoforms have been described for this gene. (provided by RefSeq)

면역원

MAG (NP_002352, 119 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR

애플리케이션

Monoclonal Anti-MAG antibody produced in mouse is suitable for immunohistochemistry (formalin-fixed, paraffin-embedded sections), indirect ELISA, and western blot applications.

생화학적/생리학적 작용

Myelin-associated glycoprotein (MAG) is a glycoprotein with five Ig-like domains belonging to the siglec family of molecules (sialic acid-binding, immunoglobulin-like lectins). It is highly involved in the myelin formation and its maintenance. It is expressed in oligodendrocyte processes at the axoglial junction. It possesses sialic acid binding affinity. Deletion of MAG region leads to Kearns-Sayre syndrome characterized with oligodendrocyte loss and nuclear translocation of apoptosis-inducing factor. MAG also has been reported as an important inhibitor of axonal regeneration.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable