콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

SAB1401172

Sigma-Aldrich

Anti-CFH antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

동의어(들):

ARMD4, ARMS1, CFHL3, FH, FHL1, HF

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

종 반응성

human

기술

western blot: 1 μg/mL

NCBI 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... CFH(3075)

일반 설명

This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short concensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

면역원

CFH (NP_001014975.1, 1 a.a. ~ 449 a.a) full-length human protein.

Sequence
MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL

생화학적/생리학적 작용

CFH (complement factor H) is a negative regulator of alternate pathway. It is known to suppress spontaneous complement activation on self surfaces alone, and is therefore surface selective. CFH possesses decay-accelerating activity and destabilizes C3b amplification in the alternate complement pathway. CFH is responsible for C3b cleavage by its cofactor activity. CFH is a membrane cofactor protein, variation in which is associated with a number of diseases such as age-related macular degeneration, kidney disorder and C3 glomerulopathy. The penetrance is found to be low in many diseases. CFH might prevent complement activation in ischaemic renal injury by binding to tubular epithelial cells.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Genetic factors in nonsmokers with age-related macular degeneration revealed through genome-wide gene-environment interaction analysis.
Naj AC
Annals of Human Genetics, 77(3), 215-231 (2013)
Properdin and factor H production by human dendritic cells modulates their T-cell stimulatory capacity and is regulated by IFN-?.
Dixon KO
European Journal of Immunology, 47(3), 470-480 (2017)
Interaction of uromodulin and complement factor H enhances C3b inactivation.
Liu M
Journal of Cellular and Molecular Medicine, 20(10), 1821-1828 (2016)
Adam C Naj et al.
Annals of human genetics, 77(3), 215-231 (2013-04-13)
Relatively little is known about the interaction between genes and environment in the complex etiology of age-related macular degeneration (AMD). This study aimed to identify novel factors associated with AMD by analyzing gene-smoking interactions in a genome-wide association study of
Maojing Liu et al.
Journal of cellular and molecular medicine, 20(10), 1821-1828 (2016-04-27)
Recent studies suggest that uromodulin plays an important role in chronic kidney diseases. It can interact with several complement components, various cytokines and immune system cells. Complement factor H (CFH), as a regulator of the complement alternative pathway, is also

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.