콘텐츠로 건너뛰기
Merck
모든 사진(10)

주요 문서

SAB1400160

Sigma-Aldrich

Monoclonal Anti-SMAD3 antibody produced in mouse

clone 7F3, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-DKFZP586N0721, Anti-DKFZp686J10186, Anti-HSPC193, Anti-HsT17436, Anti-JV152, Anti-MADH3, Anti-MGC60396, Anti-Smad 3

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

7F3, monoclonal

양식

buffered aqueous solution

종 반응성

human, rat

기술

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

동형

IgG1κ

UniProt 수납 번호

응용 분야

research pathology

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SMAD3(4088)

일반 설명

Mothers against decapentaplegic homolog 3 (SMAD3) protein is an important constituent of the transforming growth factor-beta (TGF-β) signaling pathway. Mad homology 1 (MH1) and Mad homology 2 (MH2) are the two functional domains of the SMAD3. The SMAD3 gene is located on human chromosome 15q22.33.

면역원

SMAD3 (NP_005893, 120 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL

애플리케이션

Monoclonal Anti-SMAD3 antibody produced in mouse has been used in immunohistochemistry (1:200).

생화학적/생리학적 작용

Mothers against decapentaplegic homolog 3 (SMAD3) protein possesses tumor-suppressive actions. It is involved in epithelial to mesenchymal transition (EMT). SMAD3 also possesses tumor-promoting actions of transforming growth factor-beta (TGF-β). The N-terminal domain Mad homology 1 (MH1) of SMAD3 plays a role in DNA binding. The SMAD3 gene mutation is linked to an increased incidence of knee osteoarthritis. DNA methylation change in the SMAD3 gene promoter is associated with atopic asthma. SMAD3 protein plays a regulatory role in immune responses. It also modulates fibrosis in the airways.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Bertrand Chesneau et al.
Molecular genetics & genomic medicine, 8(5), e1132-e1132 (2020-03-11)
Pathogenic SMAD3 variants are responsible for a cardiovascular phenotype, mainly thoracic aortic aneurysms and dissections. Precocious identification of the vascular risk such as aortic dilatation in mutated patients has a major impact in terms of management, particularly to avoid dissection
Astrid Jeibmann et al.
Journal of neuro-oncology, 131(3), 477-484 (2017-01-22)
Atypical teratoid/rhabdoid tumors (ATRT) are highly malignant brain tumors arising in young children. The majority of ATRT is characterized by inactivation of the chromatin remodeling complex member SMARCB1 (INI1/hSNF5). Little is known, however, on downstream pathways involved in the detrimental
Tianli Cheng et al.
International journal of oncology, 45(5), 1977-1988 (2014-09-02)
Altered expression of miRNAs contributes to development and progression of non-small cell lung cancer (NSCLC), while transforming growth factor-β (TGF-β) promotes NSCLC cell epithelial-mesenchymal transition. This study aimed to investigate the effects of TGF-β-induced miR‑143 expression in regulation of NSCLC
Nicolás Tobar et al.
BMC cancer, 14, 640-640 (2014-09-02)
Hard consistency, developed under the influence of tumor cell factors, is a characteristic feature of a breast tumor. Activation of resident fibroblasts leading to a myofibroblast phenotype is the principal feature that orchestrates this fibrotic process. The aim of this
Jinyi Han et al.
Experimental biology and medicine (Maywood, N.J.), 239(3), 272-283 (2014-02-07)
All-trans retinoic acid (ATRA) has been used for the treatment of acute promyelocytic leukemia. It remains unclear, however, whether ATRA affects cyclooxygenase-2 (COX-2; an enzyme involved in prostaglandin production), PGE2, and thromboxane A2 (TXA2) (metabolic products of COX-2) by a

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.