SAB1400141

Monoclonal Anti-IL15 antibody produced in mouse

clone 3A3, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-IL15, Anti-MGC9721
• MDL number: MFCD01635264
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3A3, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG2aκ
• UniProt 수납 번호: P40933
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... IL15(3600)

설명

일반 설명

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other′s activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. (provided by RefSeq)

면역원

IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein.

Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

생화학적/생리학적 작용

Interleukin-15 (IL-15) stimulates the proliferation of T lymphocytes and shares many biological properties with IL-2. It exerts its biological activities primarily on T cells. It is also essential in the development, survival and activation of NK cells. On binding to its receptor, IL-15 is indirectly involved in activating proto-oncogenes. Increased expression of IL-15 has been implicated with rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis and diseases affiliated with retroviruses like human immunodeficiency virus (HIV) and human T-lymphotropic virus-1 (HTLV-I).

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable