MSST0063

SILu^™Prot IGF-1, Insulin Growth Factor -1 human

recombinant, expressed in E. coli, SIL MS Protein Standard, ¹⁵N-labeled

• 동의어(들): IGF-A, Human, Insulin Growth Factor-I, Human, Insulin-Like Growth Factor-I, Human, Insulin-like growth factor I, Myotrophin, SM-C, Somatomedin 1, Sulfation Factor C, rhIGF-I
• UNSPSC 코드: 23201100
• NACRES: NA.12

속성

• 재조합: expressed in E. coli
• Quality Level: 200
• 분석: ≥95% (SDS-PAGE)
• 형태: lyophilized
• 효능: ≥97% (Heavy amino acids incorporation efficiency by MS)
• 적합성: suitable for mass spectrometry (standard)
• UniProt 수납 번호: P05019 (Gly49-Ala118)
• 배송 상태: ambient
• 저장 온도: −20°C

설명

일반 설명

SILu^™Prot IGF-1 is a recombinant, stable ¹⁵N isotope-labeled human IGF-1. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of IGF-1 in mass-spectrometry. SILu^™Prot IGF-1 is a protein of 70 amino acids, with a calculated molecular mass of 7.74 kDa.

생화학적/생리학적 작용

Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.

서열

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

물리적 형태

Supplied as a lyophilized powder containing tris buffered saline and methionine

법적 정보

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable