MSST0062

SILu^™Lite APOD, Apolipoprotein D human

recombinant, expressed in HEK 293 cells, MS Protein Standard, ≥95% (SDS-PAGE)

• 동의어(들): Apo-D, ApoD
• UNSPSC 코드: 12352200

속성

• 재조합: expressed in HEK 293 cells
• Quality Level: 200
• 분석: ≥95% (SDS-PAGE)
• 형태: lyophilized powder
• UniProt 수납 번호: P05090
• 배송 상태: ambient
• 저장 온도: −20°C
• 유전자 정보: human ... APOD(347)

설명

일반 설명

SILu^™Lite APOD is a recombinant human protein expressed in human 293 cells. It consists of 189 amino acids (including a C-terminal polyhistidine tag), with a calculated molecular mass of 21.69 kDa. SILu^™Lite APOD is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

생화학적/생리학적 작용

Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.

서열

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline.

법적 정보

SILu is a trademark of Sigma-Aldrich Co. LLC

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable