콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

HPA055619

Sigma-Aldrich

Anti-DEPDC5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

DEPDC5 Antibody - Anti-DEPDC5 antibody produced in rabbit, Depdc5 Antibody, Anti-DEP domain containing 5, Anti-DEP.5, Anti-KIAA0645

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunofluorescence: 0.25-2 μg/mL

면역원 서열

YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... DEPDC5(9681)

일반 설명

The DEP domain containing 5 (DEPDC5) gene encodes DEP domain-containing protein 5. DEPDC5 protein is made of five functional domains, such as N-terminal domain, a steric hindrance for enhancement of nucleotidase activity domain, disheveled, egl-10, and pleckstrin (DEP) domain, the structural axis for binding arrangement domain, and C-terminal domain. The DEPDC5 gene is located on the human chromosome at 22q12.2-q12.3.

면역원

DEP domain containing 5 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-DEPDC5 antibody produced in rabbit has been used in immunofluorescence (1:100).

생화학적/생리학적 작용

DEP domain containing 5 (DEPDC5) acts as a negative regulator of mammalian target of rapamycin complex 1 (mTORC1). It is a part of the GTPase-activating protein activity. Mutations in the DEPDC gene that lead to autosomal dominant familial focal epilepsy with variable foci (FFEVF), familial temporal lobe epilepsy, and autosomal dominant nocturnal frontal lobe epilepsy.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST78172

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Stéphanie Baulac et al.
Annals of neurology, 77(4), 675-683 (2015-01-28)
The DEPDC5 (DEP domain-containing protein 5) gene, encoding a repressor of the mTORC1 signaling pathway, has recently emerged as a major gene mutated in familial focal epilepsies. We aimed to further extend the role of DEPDC5 to focal cortical dysplasias
Yuki Mizuno et al.
Scientific reports, 8(1), 106-106 (2018-01-10)
Decrease in blood concentration of branched-chain amino acids, especially leucine, is known to promote liver carcinogenesis in patients with chronic liver disease, but the mechanism is unclear. We herein established hepatocellular carcinoma (HCC) cells knocked out for DEPDC5 by using
Liu Liu et al.
Frontiers in neuroscience, 14, 821-821 (2020-08-28)
To explore the phenotype spectrum of DEPDC5 variants and the possible mechanisms underlying phenotypical variation, we performed targeted next-generation sequencing in 305 patients with focal epilepsies and 91 patients with generalized epilepsies. Protein modeling was performed to predict the effects
Madeline G Andrews et al.
eLife, 9 (2020-09-03)
Outer radial glial (oRG) cells are a population of neural stem cells prevalent in the developing human cortex that contribute to its cellular diversity and evolutionary expansion. The mammalian Target of Rapamycin (mTOR) signaling pathway is active in human oRG

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.