HPA051870

Anti-TMEM119 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Tmem119 Antibody, Tmem119 Antibody - Anti-TMEM119 antibody produced in rabbit, Anti-transmembrane protein 119
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA051870
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: independent; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunohistochemistry: 1:500-1:1000
• 면역원 서열: GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS
• UniProt 수납 번호: Q4V9L6
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TMEM119(338773)

설명

일반 설명

Transmembrane protein 119 (TMEM119) is encoded by the gene mapped to human chromosome 12q23.3. The encoded protein belongs to the transmembrane protein family. TMEM119 has an O-glycosylated N-terminal region.

면역원

transmembrane protein 119 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-TMEM119 antibody produced in rabbit has been used in immunohistochemistry.

생화학적/생리학적 작용

Transmembrane protein 119 (TMEM119) acts as an osteoinductive factor and facilitates proliferation, migration and invasion of osteosarcoma cells.(28} It is a critical molecule acting downstream of the parathyroid hormone (PTH) and similar to mothers against decapentaplegic-3 (Smad3) signaling pathways in osteoblasts. TMEM119 is considered to be a potential microglial marker that differentiates resident microglia from blood-derived macrophages in the human brain. Mutation in the gene is associated with the development of osteosarcoma.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST85802

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1