HPA031075

Anti-CTGF antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2

• 동의어(들): Anti-CCN2, Anti-IGFBP8, Anti-connective tissue growth factor
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA031075
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• 면역원 서열: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
• UniProt 수납 번호: P29279
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CTGF(1490)

설명

일반 설명

The CTGF (connective tissue growth factor) gene is mapped to human chromosome 6q23.2. The encoded protein contains five domains namely, secretory signal peptide, insulin-like growth factor-binding protein, von Willebrand factor type C repeat, thrombospondin type-1 repeat and C-terminal cystine-knot-containing domain. Th gene is broadly expressed in many cells including fibroblasts, myofibroblasts, endothelial cells, smooth muscle cells and some epithelial cell types. It is either released to extracellular matrix or is located on the cell membrane.

면역원

connective tissue growth factor recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

CTGF (connective tissue growth factor) regulates cell communication with the extracellular matrix also inducing collagen deposition, stimulation and differentiation of mesenchymal cells and tissue remodeling. Abnormal expression of CTGF is associated with pathological conditions such as arthritis, fibrosis, and cancers. CTGF might control epithelial-mesenchymal transition, a signal pathway that contains an important step associated with tumor cell metastasis, in many types of cancer. Overexpression of CTGF enhances esophageal squamous cell carcinoma by associating with TGF-β (transforming growth factor β) pathway. It is involved in the development of fibrotic tissues in different types of organs. Overexpression of CTGF leads to fibrosis in many disease condition. Overexpression of CTGF is observed in joint capsule during joint contracture. CTGF is associated with inflammation reactions and controls macrophage adhesion and migration.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST77406

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable