HPA029691
Anti-SIRT4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1
동의어(들):
Anti-SIR2L4, Anti-sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
로그인조직 및 계약 가격 보기
모든 사진(3)
About This Item
추천 제품
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
VLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SIRT4(23409)
일반 설명
SIRT4 (sirtuin 4) belongs to sirtuin family of nicotinamide adenine dinucleotide-dependent enzymes. It is a NAD+-dependent ADP ribosyltransferase, that is located in the mitochondria. SIRT4 protein level is found to be more in ESCC (esophageal squamous cell carcinoma) tissues.
면역원
sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-SIRT4 has been used in immunohistochemistry.
생화학적/생리학적 작용
SIRT4 (sirtuin 4) may involve in the development of esophageal cancer. Growth of HeLa cells can be suppressed by the overexpression of SIRT4. It modulates glutamine metabolism and may also act as a tumor suppressor. It plays some important roles in multiple cellular processes like stress response and longevity. It may act as an important therapeutic target in colorectal cancer.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST78151
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Tumour-suppressive function of SIRT4 in human colorectal cancer
Miyo M, et al.
British Journal of Cancer, 113(3), 492-499 (2015)
Kristin A Anderson et al.
Cell metabolism, 25(4), 838-855 (2017-04-06)
Sirtuins are NAD+-dependent protein deacylases that regulate several aspects of metabolism and aging. In contrast to the other mammalian sirtuins, the primary enzymatic activity of mitochondrial sirtuin 4 (SIRT4) and its overall role in metabolic control have remained enigmatic. Using
SIRT4 is upregulated in Chinese patients with esophageal cancer
Lai X, et al.
International Journal of Clinical and Experimental Pathology, 9(10), 10543-10549 (2016)
Zhouxun Chen et al.
OncoTargets and therapy, 12, 2397-2408 (2019-04-18)
SIRT4, a protein localized in the mitochondria, is one of the least characteristic members of the sirtuin family. It is known that SIRT4 has deacetylase activity and plays a role in energy metabolism, but little is known about its possible
β-Cell-specific ablation of sirtuin 4 does not affect nutrient-stimulated insulin secretion in mice.
Frank K Huynh et al.
American journal of physiology. Endocrinology and metabolism, 319(4), E805-E813 (2020-09-01)
Sirtuins are a family of proteins that regulate biological processes such as cellular stress and aging by removing posttranslational modifications (PTMs). We recently identified several novel PTMs that can be removed by sirtuin 4 (SIRT4), which is found in mitochondria.
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.