HPA026816

Anti-SEC11C antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-SEC11 homolog C (S. cerevisiae), Anti-SEC11L3, Anti-SPC21, Anti-SPCS4C
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA026816
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: recombinant expression; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• 면역원 서열: MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV
• UniProt 수납 번호: Q9BY50
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SEC11C(90701)

설명

일반 설명

SEC11 homolog C (SEC11C), mapped to human chromosome 18, encodes signal peptidase complex subunit 21 (SPC21) protein. The encoded protein is characterized with two hydrophobic domains, one at amino terminal end between signal peptidase complex 18 (SPC 18) residues 17-57, which functions as a transmembrane anchor and other hydrophobic domain is mapped between SPC 18 residues 144 and 176.

면역원

SEC11 homolog C (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-SEC11C antibody has been used in western blotting.

Anti-SEC11C antibody produced in rabbit has been used in western blotting. All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

In gastric cancer, SPC18 (signal peptidase complex 18) protein, coded by SEC11C (SEC11 homolog C, signal peptidase complex subunit), helps in the development through TGF-α(transforming growth factor alpha)secretion. SPC proteins present in vitro may participate in the mechanism of signal peptide processing and protein translocation.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70171

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1