HPA026808

Anti-PRRX2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-C17orf33, Anti-G-CSF, Anti-GCSF, Anti-MGC45931, Anti-PMX2, Anti-PRX2, Anti-paired related homeobox 2
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA026808
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:200- 1:500
• 면역원 서열: RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
• UniProt 수납 번호: Q99811
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PRRX2(51450)

설명

일반 설명

Paired related homeobox 2 (PRRX2) is a member of PRRX gene family, which is encoded by a gene mapped to human chromosome 9q34.1. It is primarily expressed in proliferating fetal fibroblasts and developing dermis. Apart from this, reverse transcription polymerase chain reaction (RT-PCR) analysis of human tissue revealed the presence of PRRX2 in the kidney and lung.

면역원

paired related homeobox 2 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

생화학적/생리학적 작용

Paired related homeobox 2 (PRRX2), along with homeobox B13(HOXB13), plays a vital role in scarless fetal skin regeneration. Mutations in the PRRX2 gene might lead to (NAFD) syndrome. Experimental studies on NIH-3T3cells (mouse embryonic fibroblast cell line) shows that conserved PRX domain of PRRX2 facilitates cell-specific and promoter-dependent transcriptional regulation. In rat, PRRX2 facilitates embryonic pituitary development by promoting vasculogenesis.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70972

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable