HPA026797

Anti-DGKQ antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-DAGK, Anti-DAGK4, Anti-DAGK7, Anti-diacylglycerol kinase
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA026797

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:20- 1:50
• 면역원 서열: HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG
• UniProt 수납 번호: P52824
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... DGKQ(1609)

설명

일반 설명

Diacylglycerol kinase θ (DGKθ) of 941 amino acids with molecular mass of ~ 110 kDa is encoded by a gene mapped to human chromosome 4p16.3. DGKθ, also known as diacylglycerol kinase 4 (DAGK4), belongs to group V of DGK protein family. It is characterized with three cysteine-rich domains, N-terminal proline/ glycine-rich domain, a pleckstrin homology domain and Ras-associating domain. DGKθ needs polybasic cofactor and acidic phospholipids for its absolute activity. DGKθ is highly expressed in brain and at low level in the small intestine, duodenum and liver.

면역원

diacylglycerol kinase, theta 110kDa recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-DGKQ antibody produced in rabbit has been used in western blotting. All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

생화학적/생리학적 작용

Diacylglycerol kinase theta (DGKθ) plays a vital role in synthesizing phosphatidic acid (PA) ligand for the nuclear receptor steroidogenic factor 1 (SF1) and functions in the regulation of adrenocortical steroidogenesis. DGKθ expression is essential for SF1/cAMP (cyclic adenosine monophosphate) stimulated CYP17A1 (Cytochrome P450 17A1) transcription and it also promotes steroid hormone production in human adrenocortical cells.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST86847

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable