HPA023973

Anti-EIF3E antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Eukaryotic translation initiation factor 3 subunit 6, Anti-Eukaryotic translation initiation factor 3 subunit E, Anti-Viral integration site protein INT-6 homolog, Anti-eIF-3 p48, Anti-eIF3e
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA023973
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human, rat, mouse
• 향상된 검증: RNAi knockdown; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• 면역원 서열: ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
• UniProt 수납 번호: P60228
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... EIF3E(3646)

설명

일반 설명

KRT15 (keratin 15) is a structural protein which is a member of the acidic or type I keratin family. It is a cytoskeletal protein, which pairs with its basic or type II partner, K5 to assemble into a keratin filament network. It is a phenotypic marker for hair follicle bulge, skin keratinocyte, and limbal epithelial stem cells. This protein is expressed by basal layers of stratified epithelium. This gene is localized to human chromosome 17.

면역원

Eukaryotic translation initiation factor 3 subunit E recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

KRT15 (keratin 15) is a component of the intermediate filament network of the basal layer of stratified epithelia, and mutation in this gene results in epidermolysis bullosa simplex (EBS). This disorder is characterized by basal layer blistering due to cell fragility. The expression of this protein is elevated by interferon (IFN)-γ and thyroid hormone, and thus, they have potential as therapeutic agents for EBS. This protein is also expressed in a population of high-risk breast carcinomas. The expression pattern of this protein might be useful in differentiating trichoepithelioma (TE) from basal cell carcinoma (BCC).

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST74683

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable