HPA023924
Anti-RPAIN antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2
동의어(들):
Anti-MGC4189, Anti-RIP, Anti-RPA interacting protein, Anti-hRIP
로그인조직 및 계약 가격 보기
모든 사진(2)
About This Item
결합:
unconjugated
application:
IHC
클론:
polyclonal
종 반응성:
human
citations:
4
기술:
immunohistochemistry: 1:50- 1:200
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunohistochemistry: 1:50- 1:200
면역원 서열
YNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEEKSSLLMSCLACDTWAVI
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... RPAIN(84268)
일반 설명
RPAIN (replication protein A interacting protein), also known as RIP (RPA interacting protein), is an adaptor protein, that is transcribed into 9 isoforms as obtained from a premade human fetal brain library. The longest isoform is hRIPa, which is composed of 219 amino acids. It contains an arginine-rich basic region in its N-terminal, succeeded by an acidic region and two Zn finger-like domains in its C-terminal. hRIPβ lacks one Zn finger-like region. RPAIN gene is localized to human chromosome 17p13 and is composed of seven exons.
면역원
RPA interacting protein recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
생화학적/생리학적 작용
RPAIN (replication protein A interacting protein) functions as a linker between RPA (replication protein A) protein and importin β. This complex between the a isoform of RPAIN and importin β facilitates the transport of RPA into the nucleus. In cervical cancer cells, the a form is elevated, where it controls cell proliferation through the regulation of RPA transport. RPAINβ resides in the promyelocytic leukemia (PML) nuclear bodies, where it is responsible for the transportation of RPA into the PML bodies. It is also responsible for the release of RPA upon UV (ultraviolet) irradiation. This protein promotes the IRES (internal ribosome entry site)-mediated translation of HIV-1 (human immunodeficiency virus).
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST75599
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Junsoo Park et al.
Molecular and cellular biology, 25(18), 8202-8214 (2005-09-02)
Replication protein A (RPA) is a single-stranded-DNA-binding protein composed of three subunits with molecular masses of 70, 32, and 14 kDa. The protein is involved in multiple processes of eukaryotic DNA metabolism, including DNA replication, repair, and recombination. In Xenopus
Jin-Zhong Chen et al.
DNA and cell biology, 24(7), 464-469 (2005-07-13)
XRIP alpha was identified as an adapter protein involved in RAP nuclear import. Several homologs were reported in mammal EST analysis, but the expression pattern and genomic organization of hRIP isoforms were not clarified yet. We isolated nine isoforms of
Jinfeng Liu et al.
Journal of neuroimmune pharmacology : the official journal of the Society on NeuroImmune Pharmacology, 6(2), 308-321 (2011-03-02)
Nuclear export and translation of HIV-1 RNA are two important posttranscriptional events for HIV-1 gene expression and replication. HIV-1 Rev functions to export unspliced and incompletely spliced HIV-1 RNA from the nucleus to the cytoplasm; it requires interaction with several
Sim Namkoong et al.
FEBS letters, 586(20), 3753-3760 (2012-09-27)
Replication protein A (RPA) is a eukaryotic single-stranded DNA binding protein that is essential for DNA replication, repair, and recombination, and human RPA interacting protein α (hRIPα) is the nuclear transporter of RPA. Here, we report the regulatory role of
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.