콘텐츠로 건너뛰기
Merck
모든 사진(10)

주요 문서

HPA023900

Sigma-Aldrich

Anti-NFKB2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-DNA-binding factor KBF2, Anti-H2TF1, Anti-Lymphocyte translocation chromosome 10, Anti-Lyt10, Anti-Nuclear factor NF-kappa-B p100 subunit, Anti-Oncogene Lyt-10

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

면역원 서열

ICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQP

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... NFKB2(4791)

일반 설명

Nuclear factor-κ−B 2 (nfκb2) is a proto-oncogene mapped to human chromosome 10q24.1. The gene codes for NFκB2 subunit, also referred to as p100-p52, which is a member of NF-κB/Rel family of proteins. The encoded protein is characterized with a DNA-binding rel domain at its N-terminal end, a poly (G) hinge and an ankyrin domain at its C-terminal end. The native nfκb2 gene is localized to cytoplasm whereas the abnormal gene, which lacks IκB-like properties is expressed in nucleus.

면역원

Nuclear factor NF-kappa-B p100 subunit recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

Nuclear factor -κ-B 2 (NFκB2) is the primary protein that takes part in the noncanonical NF-κB pathway and it also aids in various cellular functions such as peripheral lymphoid organ development, B cell development, and antibody production. NFκB-2 can act as either κB-mediated transcription activator or repressor depending on the relative concentration of its dimerization partner in the nucleus.
Aberrations in the C-terminal end of the NFκB2 gene contribute to the pathogenesis of various hematopoietic tumors, such as chronic lymphocytic leukemia, multiple myeloma, and cutaneous T-cell lymphoma gene. Mutations in NFκB2 lead to a heterogeneous disorder named common variable immunodeficiency (CVID).

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST86755

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Rearranged NFKB-2 genes in lymphoid neoplasms code for constitutively active nuclear transactivators.
Chang cc
Molecular and Cellular Biology, 15(9), 5180-5187 (1995)
Germline mutations in NFKB2 implicate the noncanonical NF-?B pathway in the pathogenesis of common variable immunodeficiency.
Chen K
American Journal of Human Genetics, 93(5), 812-824 (2013)
M Heusch et al.
Oncogene, 18(46), 6201-6208 (1999-12-22)
nfkb2 encodes two members of the NF-kappa B/Rel family of proteins: p52 and p100. The p100 polypeptide has been proposed to serve as a precursor of p52, which corresponds to the N-terminal half of p100. While p52 functions as a
Haihui Lu et al.
Nature cell biology, 16(11), 1105-1117 (2014-10-01)
The cell-biological program termed the epithelial-mesenchymal transition (EMT) confers on cancer cells mesenchymal traits and an ability to enter the cancer stem cell (CSC) state. However, the interactions between CSCs and their surrounding microenvironment are poorly understood. Here we show

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.