HPA023626

Anti-Integrin beta 6 (ITGB6) Antibody

Prestige Antibodies^® Powered by Atlas Antibodies, rabbit polyclonal

• 동의어(들): Anti-integrin, beta 6
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA023626
• NACRES: NA.41

속성

• 제품명: Anti-ITGB6 antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• 면역원 서열: RGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSI
• UniProt 수납 번호: P18564
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ITGB6(3694)

설명

일반 설명

Integrin subunit β 6 (ITGB6) is a β subunit of integrin αvβ6, which is a membrane-spanning heterodimeric glycoprotein. It is encoded by the gene mapped to human chromosome 2q24.2. ITGB6 is solely expressed on epithelial cells during embryogenesis.

면역원

integrin, beta 6 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-ITGB6 antibody produced in rabbit has been used in immunohistochemistry.

생화학적/생리학적 작용

Integrin subunit β 6 (ITGB6) contributes to colorectal cancer (CRC) pathogenesis by activating latent transforming growth factor β (TGFβ) and maintaining TGFβ-mediated epithelial-to-mesenchymal transition (EMT). Therefore, ITGB6 can be used as a serum marker for CRC. Increased expression of ITGB6 has been observed in various processes requiring tissue remodeling such as wound healing, fibrosis, and cancer. Mutation of the ITGB6 gene leads to the development of autosomal recessive amelogenesis imperfecta, alopecia, periodontitis, and emphysema. Deletion of the gene causes pulmonary dysfunction.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70079

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable