HPA022268
Anti-LPCAT1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2
동의어(들):
Anti-1-Acylglycerophosphocholine O-acyltransferase 1, Anti-AYTL2, Anti-Acyltransferase-like 2, Anti-Lung-type acyl-CoA:lysophosphatidylcholine acyltransferase 1, Anti-Lysophosphatidylcholine acyltransferase 1, Anti-Phosphonoformate immuno-associated protein 3
로그인조직 및 계약 가격 보기
모든 사진(8)
About This Item
결합:
unconjugated
application:
IHC
클론:
polyclonal
종 반응성:
human
citations:
6
기술:
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000
immunohistochemistry: 1:500-1:1000
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSV
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... AYTL2(79888)
면역원
1-acylglycerophosphocholine O-acyltransferase 1 recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Immunohistochemistry (1 paper)
생화학적/생리학적 작용
LPCAT1 (lysophosphatidylcholine acyltransferase 1) is a phospholipase that plays a major role in phospholipid remodeling. During remodeling, it converts acyl-CoA to lyso-phosphatidyl choline, by transferring fatty acids for the reconstitution of phosphatidyl choline (PC). The de-acylation and re-acylation by a lyso-PC acyl transferase is supported by LPCAT1 through the Land′s cycle. In addition, the protein expression has been found on the surface of lipid droplets, where it plays an important role in PC biosynthesis. It has been reported that LPCAT1 may play an essential role in cancer cell proliferation, migration, and invasion.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST70255
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Xufeng Dai et al.
PloS one, 11(5), e0156542-e0156542 (2016-05-27)
Lysophosphatidylcholine acyltransferase 1 (LPCAT1) is necessary for photoreceptors to generate an important lipid component of their membranes. The absence of LPCAT1 results in early and rapid rod and cone degeneration. Retinal degeneration 11 (rd11) mice carry a mutation in the
Xufeng Dai et al.
Investigative ophthalmology & visual science, 55(3), 1724-1734 (2014-02-22)
The retinal degeneration 11 (rd11) mouse is a newly discovered, naturally occurring animal model with early photoreceptor dysfunction and rapid rod photoreceptor degeneration followed by cone degeneration. The rd11 mice carry a spontaneous mutation in the lysophosphatidylcholine acyltransferase 1 (Lpcat1)
Rozenn N Lemaitre et al.
Heart rhythm, 11(3), 471-477 (2014-01-15)
There is limited information on genetic factors associated with sudden cardiac arrest (SCA). To assess the association of common variation in genes in fatty acid pathways with SCA risk. We selected 85 candidate genes and 1155 single nucleotide polymorphisms (SNPs)
Yoshifumi Morita et al.
Journal of hepatology, 59(2), 292-299 (2013-04-10)
Several lipid synthesis pathways play important roles in the development and progression of hepatocellular carcinoma (HCC), although the precise molecular mechanisms remain to be elucidated. Here, we show the relationship between HCC progression and alteration of phospholipid composition regulated by
Frauke Beilstein et al.
Gut, 66(12), 2160-2169 (2016-09-02)
HCV is intimately linked with the liver lipid metabolism, devoted to the efflux of triacylglycerols stored in lipid droplets (LDs) in the form of triacylglycerol-rich very-low-density lipoproteins (VLDLs): (i) the most infectious HCV particles are those of lowest density due
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.