HPA018820

Anti-HOOK1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

• 동의어(들): Anti-Protein Hook homolog 1, Anti-h-hook1, Anti-hHK1
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA018820
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: rat, human
• 향상된 검증: independent; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• 면역원 서열: AFEMKRLEEKHEALLKEKERLIEQRDTLKETNEELRCSQVQQDHLNQTDASATKSYENLAAEIMPVEYREVFIRLQHENKMLRLQQEGSENERIEELQE
• UniProt 수납 번호: Q9UJC3
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... HOOK1(51361)

설명

일반 설명

The gene Hook homolog-1 (HOOK1) is mapped to human chromosome 1p32.1. It belongs to HOOK family of proteins. HOOK1 transcript is highly expressed in testis. The protein is present to discrete punctate subcellular structures.

면역원

Protein Hook homolog 1 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-HOOK1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

Protein Hook homolog-1 (HOOK1) has been shown to associate with microtubules. HOOK1 is important for cellular trafficking. It is involved in sorting of clathrin independent cargo proteins toward recycling in microtubule-dependent manner. HOOK1 in complex with FTS (fused toes) and FHIP (FTS and Hook Interacting Protein) interacts with components of the homotypic vesicular protein sorting (HOPS) complex. This interaction is important for vesicle trafficking. Absence of HOOK1 function in the azh (abnormal spermatozoon head shape) mutant mouse results in abnormalities in shape of sperm head and negatively affects attachment of the flagellum to the sperm head.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST74486

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable