콘텐츠로 건너뛰기
Merck
모든 사진(10)

주요 문서

HPA018537

Sigma-Aldrich

Anti-HOOK1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

동의어(들):

Anti-Protein Hook homolog 1, Anti-h-hook1, Anti-hHK1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

rat, mouse, human

향상된 검증

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:2500-1:5000

면역원 서열

KRALEELQEALAEKEELRQRCEELDMQVTTLQDEKNSLVSENEMMNEKLDQLDGSFDDPNTVVAKKYFHAQLQLEQLQEENFRLEAAKDDYRVHC

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... HOOK1(51361)

일반 설명

The gene protein Hook homolog-1 (HOOK1) is mapped to human chromosome 1p32.1. It belongs to HOOK family of proteins. HOOK1 transcript is highly expressed in testis. The protein localizes to discrete punctate subcellular structures.

면역원

Protein Hook homolog 1 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-HOOK1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

Protein Hook homolog-1 (HOOK1) has been shown to associate with microtubules. HOOK1 is important for cellular trafficking. It is involved in sorting of clathrin independent cargo proteins toward recycling in microtubule-dependent manner. HOOK1 in complex with FTS (Fused Toes) and FHIP (FTS and Hook Interacting Protein) interacts with components of the homotypic vesicular protein sorting (HOPS) complex. This interaction is important to promote vesicle trafficking. In the azh (abnormal spermatozoon head shape) mutant mouse, loss of HOOK1 function results in abnormal shape of sperm head and disturbs linking of the flagellum to the sperm head.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST74487

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Jun-Chao Xie et al.
American journal of translational research, 10(1), 150-163 (2018-02-10)
Hypoxia promotes the accumulation of amyloid-β (Aβ), which is related to the pathogenesis of Alzheimer's disease (AD). CD147 is considered as an additional subunit of γ-secretase regulated by hypoxia, and has been identified in exosomes. Aβ is also found in
Irene Mendoza-Lujambio et al.
Human molecular genetics, 11(14), 1647-1658 (2002-06-21)
In mice carrying the autosomal recessive mutation 'abnormal spermatozoon head shape' (azh) all spermatozoa display a highly abnormal head morphology that differs drastically from the compact and hook-shaped head of the normal murine sperm. Moreover, the azh mutation causes tail
Lai Xu et al.
Molecular biology of the cell, 19(12), 5059-5071 (2008-09-19)
Fused Toes (FTS) is a member of a small group of inactive variant E2 ubiquitin-conjugating enzyme domain-containing proteins of unknown function. Through proteomic analysis of FTS complexes purified from human embryonic kidney 293T cells, we identified a new multiprotein complex
J H Walenta et al.
The Journal of cell biology, 152(5), 923-934 (2001-03-10)
Microtubules are central to the spatial organization of diverse membrane-trafficking systems. Here, we report that Hook proteins constitute a novel family of cytosolic coiled coil proteins that bind to organelles and to microtubules. The conserved NH(2)-terminal domains of Hook proteins
Wenfeng Li et al.
Medical oncology (Northwood, London, England), 31(9), 118-118 (2014-07-30)
Enhanced glycolysis is a common trait of many types of human cancers. This study was to detect the expression pattern of three regulatory enzymes during glycolysis in esophageal squamous cell carcinoma (ESCC) and to investigate their correlation with patients' outcome

Global Trade Item Number

SKUGTIN
HPA018537-25UL4061842865932
HPA018537-100UL4061836324407

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.