콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

HPA018403

Sigma-Aldrich

Anti-RBM8A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-BOV-1, Anti-Binder of OVCA1- 1, Anti-RNA-binding motif protein 8A, Anti-RNA-binding protein 8A, Anti-RNA-binding protein Y14, Anti-Ribonucleoprotein RBM8A

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

RNAi knockdown
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

면역원 서열

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... RBM8A(9939)

일반 설명

The gene RBM8A (RNA-binding motif protein 8A) is mapped to human chromosome 1q21.1. It belongs to a conserved RNA-binding motif protein family. RBM8A is ubiquitously expressed in human tissues. The protein shuttles between the nucleus and the cytoplasm. The protein is popularly known as Y14.

면역원

RNA-binding protein 8A recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-RBM8A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

RNA-binding motif protein 8A (RBM8A) is an RNA binding protein. It is part of the exon-exon junction complex (EJC), which is present on the exon-exon junctions of spliced mRNAs. RBM8A interacts with UPF3B (up-frameshift suppressor-3 homolog B) and together they are essential for nonsense-mediated mRNA decay. RBM8A also controls the alternative splicing of apoptotic regulators. Absence of RBM8A increase production of proapoptotic Bcl-x(S) splice variant. Apart from being an exon junction complex protein, RBM8A associates with receptor-interacting protein-1 (RIP1) and TNFR (tumor necrosis factor receptor)-associated death domain, and positively regulates TNF-α-induced IL (Interleukin)-6 expression in HeLa cells. RBM8A interacts directly with decapping factor DCP2 and the 5′ cap structure of mRNAs, and inhibits the mRNA-decapping activity of DCP2. RBM8A interacts with STAT3 (signal transducer and activator of transcription-3) and regulates its activation by influencing the IL-6-induced tyrosine-phosphorylation of STAT3.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73962

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Sumihito Togi et al.
Journal of immunology (Baltimore, Md. : 1950), 191(3), 1436-1444 (2013-07-03)
Although Y14 is known to be a component of the exon junction complex, we previously reported that Y14 regulates IL-6-induced STAT3 activation. In this study, we showed that endogenous Y14 positively regulated TNF-α-induced IL-6 expression in HeLa cells. Small interfering
A M Salicioni et al.
Genomics, 69(1), 54-62 (2000-10-03)
The OVCA1 gene is a candidate for the breast and ovarian tumor suppressor gene at chromosome 17p13.3. To help determine the function(s) of OVCA1, we used a yeast two-hybrid screening approach to identify OVCA1-associating proteins. One such protein, which we
Laetitia Michelle et al.
Molecular and cellular biology, 32(5), 954-967 (2011-12-29)
Several apoptotic regulators, including Bcl-x, are alternatively spliced to produce isoforms with opposite functions. We have used an RNA interference strategy to map the regulatory landscape controlling the expression of the Bcl-x splice variants in human cells. Depleting proteins known
Naoyuki Kataoka et al.
Scientific reports, 1, 92-92 (2012-02-23)
Pre-mRNA splicing deposits multi-protein complexes, termed exon junction complexes (EJCs), on mRNAs near exon-exon junctions. The core of EJC consists of four proteins, eIF4AIII, MLN51, Y14 and Magoh. Y14 is a nuclear protein that can shuttle between the nucleus and
Norihiko Ohbayashi et al.
Biochemical and biophysical research communications, 372(3), 475-479 (2008-05-28)
Signal transducer and activator of transcription 3 (STAT3), which mediates biological actions in many physiological processes, is activated by cytokines and growth factors via specific tyrosine-phosphorylation, dimerization, and nuclear translocation. To clarify the molecular mechanisms underlying the regulation of STAT3

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.