HPA017051

Anti-DNAJB11 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-DnaJ homolog subfamily B member 11 precursor antibody produced in rabbit, Anti-ER-associated Hsp40 co-chaperone antibody produced in rabbit, Anti-ER-associated dnaJ protein 3 antibody produced in rabbit, Anti-ErJ3 antibody produced in rabbit, Anti-PWP1-interacting protein 4 antibody produced in rabbit, Anti-hDj9 antibody produced in rabbit
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA017051
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: recombinant expression; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• 면역원 서열: DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
• UniProt 수납 번호: Q9UBS4
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... DNAJB11(51726)

설명

일반 설명

DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a chaperone of the endoplasmic reticulum belonging to the endoplasmic reticulum (ER) Hsp40/DnaJ family. It is a component of quality control system of ER-associated degradation (ERAD). It contains the J domain, which is a highly conserved region made of 75 amino acids. It also shares certain domains with other HSP40 chaperones. These domains include a C-terminal domain, a glycine/phenylalanine-rich putative linker region and a cystine-rich domain. DNAJB11 is expressed ubiquitously, and has the highest expression in secretory tissues.

면역원

DnaJ homolog subfamily B member 11 precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-DNAJB11 antibody is suitable for immunoprecipitation.
Anti-DNAJB11 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a component of unassembled immunoglobulin (Ig) heavy chain: BiP (binding immunoglobulin protein) complex, where it acts as a co-factor for BiP, and helps in folding and assembly of proteins. It plays a major role in mammalian cell resistance to vero toxin. It is also involved in ER (endoplasmic reticulum) stress tolerance. It is secreted in the extracellular space, where it binds to mis-folded proteins and prevents their aggregation. It also reduces the toxicity of disease-related prion protein. DNAJB11 is involved in the intoxication pathway of cholera toxin.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71693

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)