추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PFTK1(5218)
일반 설명
CDK14 (cyclin-dependent kinase 14) belongs to a 21 member cyclin dependent kinase gene family. It is also called PFTK1 or PFTAIRE1. This family contains two groups- 10 classical CDKs and the rest 11 are members of a new group. This gene is localized to human chromosome 7q21.13, and has a high expression level in brain, heart, pancreas, kidney, ovaries and testis. In lungs, it is expressed in bronchial and alveolar epithelium.
면역원
Serine/threonine-protein kinase PFTAIRE-1 recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-CDK14 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Immunohistochemistry (1 paper)
생화학적/생리학적 작용
CDK14 (cyclin-dependent kinase 14) facilitates cell division, and also has functions as an oncogene. In hepatocellular carcinoma, it aids in tumor growth and metastasis. It is overexpressed in esophageal squamous cell carcinoma (ESCC), and this is related to poor response to chemotherapy. It has potential as a marker for prognosis as well as response to chemotherapy in ESCC. Studies in mice show that cigarette smoke leads to reduced expression of this protein in both testicular and lung cells. In lungs, this results in decreased β-catenin, resulting in aberrant Wnt signaling. Studies in mice also show that this protein is involved in meiosis and differentiation of neuronal cells. It phosphorylates caldesmon, an actin-binding protein, and thus facilitates the binding of actin molecules, and the formation of stress fibers.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST73464
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
British journal of cancer, 106(5), 947-954 (2012-02-16)
Recently, PFTK1 was identified as a member of the cyclin-dependent kinase family; however, its expression and clinical significance in oesophageal squamous cell carcinoma (ESCC) have not been evaluated. PFTK1 expression was initially examined by expression microarray in 77 ESCC patients.
Toxicology letters, 234(2), 120-130 (2015-02-15)
In this study, DNA arrays have been employed to monitor gene expression patterns in testis of mice exposed to tobacco smoke for 24 weeks and compared to control animals. The results of the analysis revealed significant changes in expression of
Gene, 267(2), 165-172 (2001-04-21)
We isolated a novel member of putative Cdc2-related serine/threonine protein kinases from a Hela cell cDNA library. The cDNA encodes a protein of 469 amino acids, sharing 95% identities with the mouse PFTAIRE1 throughout the entire protein sequence. This gene
Cell death & disease, 8(10), e3103-e3103 (2017-10-13)
Osteosarcoma (OS) has emerged as the most common primary musculoskeletal malignant tumour affecting children and young adults. Cyclin-dependent kinases (CDKs) are closely associated with gene regulation in tumour biology. Accumulating evidence indicates that the aberrant function of CDK14 is involved
Molecular and cellular biochemistry, 350(1-2), 201-206 (2010-12-25)
Caldesmon (CaD) is an actin-binding protein that is capable of stabilizing actin filaments. Phosphorylation of CaD is widely accepted in the actin cytoskeletal modeling and promotion of cell migration. In this study, we show that CaD is a downstream phosphorylation
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.