HPA015104

Anti-MTDH antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-3D3/lyric antibody produced in rabbit, Anti-AEG-1 antibody produced in rabbit, Anti-Astrocyte elevated gene-1 protein antibody produced in rabbit, Anti-Lysine-rich CEACAM1 co-isolated protein antibody produced in rabbit, Anti-Metadherin antibody produced in rabbit, Anti-Metastasis adhesion protein antibody produced in rabbit, Anti-Protein LYRIC antibody produced in rabbit
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA015104
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: independent; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• 면역원 서열: NSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPA
• UniProt 수납 번호: Q86UE4
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MTDH(92140)

설명

일반 설명

MTDH (metadherin) is a transmembrane protein, which spans the membrane once, and has a molecular weight of 64kDa. It is also called astrocyte elevated gene-1 (AEG-1) and lysine-rich CEACAM1 coisolated (LYRIC). It was initially isolated from primary human fetal astrocytes, as a transcript induced by human immunodeficiency virus (HIV)-1. This gene is localized to human chromosome 8q22.1, and is expressed in human brain, with higher expression in neurons as compared to glial cells. This gene has 12 exons and 11 introns.

면역원

Protein LYRIC recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-MTDH antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

MTDH (metadherin) is highly expressed in multiple cancers such as, esophageal squamous cell carcinoma, hepatocellular carcinoma (HCC), breast, gastric, renal, prostate, colorectal cancer, non-small cell lung cancer, and glioma. It promotes angiogenesis, autophagy, tumor invasion and metastasis. It is responsible for resistance to chemotherapy and tamoxifen, and its up-regulation in invasive breast cancer is related to poor prognosis. In HER2⁺ breast cancer, it is responsible for resistance to trastuzumab. It chromosomal location is a susceptibility locus to migraine, and thus, this gene might be associated to migraine. It is up-regulated in astrocytomas, and higher the expression level, higher the grade of astrocytoma. Thus, this protein has potential as diagnostic and prognostic marker for astrocytomas. It is essential for the tumorigenesis of hepatocellular carcinoma (HCC), via the activation of NF-κB.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72055

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)