HPA014702

Anti-ZDHHC20 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-DHHC-20, Anti-Palmitoyltransferase ZDHHC20, probable, Anti-Zinc finger DHHC domain-containing protein 20
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA014702
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:20-1:50
• 면역원 서열: SSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIE
• UniProt 수납 번호: Q5W0Z9
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ZDHHC20(253832)

설명

일반 설명

ZDHHC20 (zinc finger, DHHC-type containing 20) is a palmitoyl acyltransferase (PAT), and is a sequence homolog of yeast Pfa3. It resides in the plasma membrane. It is expressed in thyroid, liver, prostate, testis, placenta, colon, breast, kidney, brain, heart, lungs, thymus, leukocytes and ovaries. It contains the DHHC motif, the cysteine residue of which is essential for its catalytic function.

면역원

Palmitoyltransferase ZDHHC20, probable recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-ZDHHC20 antibody is suitable for immunostaining. Anti-ZDHHC20 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

ZDHHC20 (zinc finger, DHHC-type containing 20) is shown to plamitoylate myristoyl motif, present at the N-terminal. Palmitoylation of proteins such as, Src-related tyrosine kinases, results in cell proliferation mediated through cell signaling. In vitro studies show that this gene is up-regulated in multiple human cancer tissues, which promotes anchor-independent cell growth. Thus, this gene might hold potential as an anti-cancer therapeutic target. Its expression is altered in breast cancer, where it is involved in the control of cell cycle and cell migration. It might therefore, have therapeutic implications in triple negative breast cancer (TNBC).

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73173

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)