HPA014659

Anti-UAP1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-AGX antibody produced in rabbit, Anti-Antigen X antibody produced in rabbit, Anti-Sperm-associated antigen 2 antibody produced in rabbit, Anti-UDP-N-acetylhexosamine pyrophosphorylase antibody produced in rabbit
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA014659
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: RNAi knockdown; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• 면역원 서열: NDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSHQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQ
• UniProt 수납 번호: Q16222
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... UAP1(6675)

설명

일반 설명

UAP1 (UDP-N-acetylglucosamine pyrophosphorylase 1) is a phosphorylase enzyme, which in humans, contains two alternatively spliced isoforms called AGX1 and AGX2. AGX2 has an extra 17-amino acid sequence. UAP1 was first partially purified and characterized from yeast, Neurospora crassa, calf liver and sheep brain. It has three domains, with an SGC superfamily domain in the center. The other two domains are small and make up the N- and C-termini. The center of the core domain contains the nucleotide sugar binding domain. AGX1 is composed of predicted 505 amino acids and AGX2 of 521 amino acids. Their putative molecular weights are ~55.5kDa and ~57.3kDa respectively. This protein is expressed in placenta and testis in the primary spermatocytes.

면역원

UDP-N-acetylglucosamine pyrophosphorylase 1

애플리케이션

Anti-UAP1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

생화학적/생리학적 작용

UAP1 (UDP-N-acetylglucosamine pyrophosphorylase 1) catalyzes the formation of UDP-N-acetylglucosamine (UDPGlcNAc) from UTP and GlcNAc1P, in cytoplasm, in the presence of Mg²⁺/Mn²⁺. The AGX2 isoform has more affinity for GlcNAc1P than AGX1 isoform. It is a component of the human sperm outer dense fibers (ODFs). It might function in normal sperm motility and related male infertility. This gene is up-regulated in androgen receptor (AR)-positive prostate cancer cell lines

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70683

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)