콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

HPA014048

Sigma-Aldrich

Anti-CYP4F2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-CYPIVF2, Anti-Cytochrome P450 4F2, Anti-Cytochrome P450-LTB-omega, Anti-Leukotriene-B(4) 20-monooxygenase, Anti-Leukotriene-B(4) omega-hydroxylase

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.43

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunohistochemistry: 1:20- 1:50

면역원 서열

RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... CYP4F2(8529)

일반 설명

The gene CYP4F2 (cytochrome P450 family 4 subfamily F member 2) encodes a protein belonging to the P450 superfamily of enzymes. The gene is mapped to human chromosome 19p13.12. It is expressed in human liver and renal microsomes. It is mostly localized to the S2 and S3 segments of the proximal tubule in kidney.

면역원

Cytochrome P450 4F2 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-CYP4F2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

The gene CYP4F2 (cytochrome P450 family 4 subfamily F member 2) encodes a Vitamin K1 oxidase that catalyzes the hydroxylation of the tocopherol phytyl side chain in the inactivation pathway of vitamin E. It mediates the ω-hydroxylation of arachidonic acid to 20-HETE (20-Hydroxyeicosatetraenoic acid) in human liver. 20-HETE is involved in the control of kidney vascular and tubular function, vascular tone control in cerebral and coronary circulation, and in turn, blood pressure. Polymorphism in this gene is associated with altered requirement of warfarin dose used to treat thrombotic events. Aberration V433M (rs2108622) in this gene is linked to ischemic stroke in the Northern Chinese Han population.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72369

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Daniel R Jensen et al.
American journal of medical genetics. Part A, 149A(3), 396-402 (2009-02-14)
We describe a patient with multiple congenital anomalies including deafness, lacrimal duct stenosis, strabismus, bilateral cervical sinuses, congenital cardiac defects, hypoplasia of the corpus callosum, and hypoplasia of the cerebellar vermis. Mutation analysis of EYA1, SIX1, and SIX5, genes that
Michael D Caldwell et al.
Blood, 111(8), 4106-4112 (2008-02-06)
Warfarin is an effective, commonly prescribed anticoagulant used to treat and prevent thrombotic events. Because of historically high rates of drug-associated adverse events, warfarin remains underprescribed. Further, interindividual variability in therapeutic dose mandates frequent monitoring until target anticoagulation is achieved.
Anna Alexanian et al.
Cancer genomics & proteomics, 9(4), 163-169 (2012-07-17)
20-Hydroxyeicosatetraenoic acid (20-HETE), a metabolite of arachidonic acid (AA) produced by the CYP4A and CYP4F enzyme families has been reported to induce mitogenic and angiogenic responses both in vitro and in vivo, and inhibitors of this pathway reduced growth of
J M Lasker et al.
The Journal of biological chemistry, 275(6), 4118-4126 (2000-02-08)
20-hydroxyeicosatetraenoic acid (20-HETE), an omega-hydroxylated arachidonic acid (AA) metabolite, elicits specific effects on kidney vascular and tubular function that, in turn, influence blood pressure control. The human kidney's capacity to convert AA to 20-HETE is unclear, however, as is the
Shumin Deng et al.
Progress in neuro-psychopharmacology & biological psychiatry, 34(4), 664-668 (2010-03-17)
CYP4F2 is a member of the cytochrome P450 enzymes and is responsible for metabolizing arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE); 20-HETE plays a role in the regulation of vascular tone in the cerebral, coronary, and renal circulation. The present study

문서

Phase I biotransformation reactions introduce or expose functional groups on the drug with the goal of increasing the polarity of the compound. Although Phase I drug metabolism occurs in most tissues, the primary and first pass site of metabolism occurs during hepatic circulation.

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.