HPA013650

Anti-MAGI2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Atrophin-1-interacting protein 1, Anti-Atrophin-1-interacting protein A, Anti-MAGI-2, Anti-Membrane-associated guanylate kinase inverted 2, Anti-Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
• MDL number: MFCD03791836
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA013650
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:200- 1:500
• 면역원 서열: AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMA
• UniProt 수납 번호: Q86UL8
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MAGI2(9863)

설명

일반 설명

The gene MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2) is mapped to human chromosome 7q21 and spans 1.4 megabases. It contains 21 exons encoding a 2410 amino acid protein that contains nine potential protein-protein interaction domains. These domains include one Guk (guanylate kinase-like) domain, two WW domains and six PDZ domains.

면역원

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-MAGI2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

The gene MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2) encodes a scaffolding protein that functions in the assembly of epithelial tight junction enhancing epithelial integrity. It negatively regulates cell migration and proliferation via PTEN (phosphatase and tensin homolog), a protein involved in cell growth and apoptosis. It has been implicated in celiac disease and ulcerative colitis.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72647

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)