HPA012612

Anti-CADM4 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Cell adhesion molecule 4 precursor, Anti-Immunoglobulin superfamily member 4C, Anti-Nectin-like protein 4, Anti-TSLC1-like protein 2
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA012612
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:1000-1:2500
• 면역원 서열: GGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPY
• UniProt 수납 번호: Q8NFZ8
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CADM4(199731)

설명

일반 설명

Cell adhesion molecule 4 precursor (CADM4) is a 55kDa protein expressed in the kidneys, bladder, brain and prostate gland. It belongs to the tumor suppressor in lung cancer 1 (TSLC1) gene family and the gene encoding it is present on chromosome 19q13.2. CADM4 has three Ig (immunoglobulin) loops in the extracellular domain, one transmembrane domain and a short cytoplasmic domain.

면역원

Cell adhesion molecule 4 precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

Cell adhesion molecule 4 precursor (CADM4) interacts by the formation of homo-dimers and its overexpression induces the aggregation of cells in a Ca²⁺/Mg²⁺-independent manner. It is thus involved in cell adhesion through homophilic trans-interaction. CADM4 suppresses tumor growth and in human proximal uriniferous tubules, its cytoplasmic region interacts with 4.1B, an actin binding protein which links CADM4 to different pathways. It mediates the contacts between Schwann cells and axons. The myelin unit establishment in the peripheral nervous system is taken care by CADM4. CADM4 interacts in cis with Erb-b2 receptor tyrosine kinase 3 (ErbB3), recruits protein tyrosine phosphatase non-receptor type 13 (PTPN13) and inhibits the heregulin-induced activation of the ErbB2/ErbB3 signaling pathway. It also interacts in cis with integrin-α6β4 and inhibits the disassembly of hemi desmosomes.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71553

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)