HPA010978
Anti-CDCP1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
동의어(들):
Anti-CD318 antigen, Anti-CUB domain-containing protein 1 precursor, Anti-Membrane glycoprotein gp140, Anti-SIMA135, Anti-Subtractive immunization M plus HEp3-associated 135 kDa protein, Anti-Transmembrane and associated with src kinases
로그인조직 및 계약 가격 보기
모든 사진(5)
About This Item
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
기술
immunohistochemistry: 1:20- 1:50
면역원 서열
SKHKISFLCDDLTRLWMNVEKTISCTDHRYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSFSYLVASAIPSQDLYFGSFCPGGSIKQIQVKQ
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CDCP1(64866)
일반 설명
CUB-domain-containing protein 1 (CDCP1) is a type I transmembrane protein which functions as a substrate for Src kinases. It has a molecular weight of 140kDa, and has a proteolytically cleaved form of molecular weight 85kDa. It has an intracellular region made of five tyrosines, and a large extracellular region containing the CUB (C1r/C1s, Uegf, Bmp1) domain. Both the isoforms of CDCP1 are expressed in varying ratios in epithelial cells. This gene is localized to human chromosome 3p21.31. CDCP1 protein is composed of 836 amino acids, with a signal peptide of 29 amino acids, and the cytoplasmic domain consists of 150 amino acids.
면역원
CUB domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
생화학적/생리학적 작용
CUB domain-containing protein 1 (CDCP1) is phosphorylated by Src kinases and mediates resistance to anoikis, promotes degradation of extracellular matrix, tumor invasion and metastasis. It is a cancer associated gene and is up-regulated in multiple cancers such as, lung, pancreas and kidney. Its overexpression in these cancers is related to poor prognosis. CDCP1 inhibits integrin-mediated cell adhesion by acting as a substrate of Src-kinases. It also facilitates the metastasis of melanoma, and is associated with poor prognosis of renal cell carcinoma. CDCP1 aids bone morphogenetic protein 4 (BMP4) in initiating epithelial-mesenchymal transition, and suppresses the epithelial phenotype of pancreatic cancer cells. It confers anoikis resistance to lung cancer cells, by participating in protein kinase Cδ (PKCδ) signaling.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST72141
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
Wei-Chung Shia et al.
BMC genomics, 12 Suppl 3, S23-S23 (2012-03-06)
Cardiovascular disease is the chief cause of death in Taiwan and many countries, of which myocardial infarction (MI) is the most serious condition. Hyperlipidemia appears to be a significant cause of myocardial infarction, because it causes atherosclerosis directly. In recent
Shin Miura et al.
Experimental cell research, 321(2), 209-218 (2014-01-05)
The prognosis of pancreatic cancer is dismal due to the frequent metastasis and invasion to surrounding organs. Numerous molecules are involved in the malignant behavior of pancreatic cancer cells, but the entire process remains unclear. Several reports have suggested that
Mineo Iwata et al.
PloS one, 9(10), e109304-e109304 (2014-10-03)
In vitro expanded bone marrow stromal cells contain at least two populations of fibroblasts, a CD146/MCAM positive population, previously reported to be critical for establishing the stem cell niche and a CD146-negative population that expresses CUB domain-containing protein 1 (CDCP1)/CD318.
Takamasa Uekita et al.
Cancer science, 102(11), 1943-1948 (2011-08-05)
Tumor metastasis is a complex multistep process by which cells from the primary tumor invade tissues, move through the vasculature, settle at distant sites and eventually grow to form secondary tumors. Altered tyrosine phosphorylation signals in cancer cells contribute to
Danislav S Spassov et al.
Molecular and cellular biology, 31(4), 766-782 (2010-12-30)
Trask is a recently described transmembrane substrate of Src kinases whose expression and phosphorylation has been correlated with the biology of some cancers. Little is known about the molecular functions of Trask, although its phosphorylation has been associated with cell
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.