HPA009066
Anti-TPM3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
동의어(들):
Anti-Tropomyosin α-3 chain antibody produced in rabbit, Anti-Tropomyosin γ antibody produced in rabbit, Anti-Tropomyosin-3 antibody produced in rabbit, Anti-hTM5 antibody produced in rabbit
로그인조직 및 계약 가격 보기
모든 사진(3)
About This Item
UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
종 반응성
human, mouse, rat
기술
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
AERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSA
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TPM3(7170)
관련 카테고리
일반 설명
TPM3 (tropomyosin 3) gene is localized to human chromosome 1q21.3, and codes for an actin-binding protein. It is present in skeletal and smooth muscles, as well as certain non-muscular tissues. It functions as an oncogene.
면역원
Tropomyosin α-3 chain recombinant protein epitope signature tag (PrEST)
애플리케이션
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
생화학적/생리학적 작용
TPM3 (tropomyosin 3) is involved in the stabilization of cytoskeleton microfilaments. Upon induction by Ca2+ in skeletal muscles, it mediates the actin-myosin response. However, its function in non-muscular cells is still not clear. TPM3-ALK (anaplastic lymphoma receptor tyrosine kinase) fusion through (1;2) translocation results in hematopoietic tumorigenesis. Fusion with NTRK1 and PDGFRB genes results in the induction of papillary thyroid carcinoma and chronic eosinophilic leukemia. It is responsible for the migration and invasion in hepatocellular carcinoma by facilitating EMT (epithelial-mesenchymal transition) in a Snail-dependent manner. Expression of this protein in tumors is positively linked with the expression of MMP (matrix metalloproteinases). Hence, this protein plays a key role in the progression of gliomas. Mutations in this gene are responsible for the neuromuscular defects in patients with congenital myopathy with fibre type disproportion (CFTD).
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST70731
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Tao Tao et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 35(9), 9053-9059 (2014-06-11)
Recent studies have shown that many molecular mechanisms, such as the EGFR, AKT, STAT3, and beta-catenin pathways, are involved in glioma. However, the prognosis of the disease remains poor. Explorations of the underlying mechanisms of glioma and identification of effective
T Schreckenbach et al.
Neuromuscular disorders : NMD, 24(2), 117-124 (2013-11-19)
Cap myopathy is a rare congenital myopathy characterized by the presence of caps within muscle fibres and caused by mutations in ACTA1, TPM2 or TPM3. Thus far, only three cases with TPM3-related cap myopathy have been described. Here, we report
P Munot et al.
Neuromuscular disorders : NMD, 20(12), 796-800 (2010-10-19)
Congenital myopathy with fibre type disproportion (CFTD) has been associated with mutations in ACTA1, SEPN1, RYR1 and TPM3 genes. We report the clinico-pathological and electrophysiological features of 2 unrelated cases with heterozygous TPM3 mutation. Case 1 is a 19-year-old lady
D C Singleton et al.
Oncogene, 34(36), 4713-4722 (2014-12-09)
Hypoxia is a common feature of locally advanced breast cancers that is associated with increased metastasis and poorer survival. Stabilisation of hypoxia-inducible factor-1α (HIF1α) in tumours causes transcriptional changes in numerous genes that function at distinct stages of the metastatic
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.