콘텐츠로 건너뛰기
Merck
모든 사진(5)

주요 문서

HPA005525

Sigma-Aldrich

Anti-PRMT5 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-72 kDa ICln-binding protein antibody produced in rabbit, Anti-Jak-binding protein 1 antibody produced in rabbit, Anti-Protein arginine N-methyltransferase 5 antibody produced in rabbit, Anti-SKB1Hs antibody produced in rabbit, Anti-Shk1 kinase-binding protein 1 homolog antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human, mouse, rat

향상된 검증

RNAi knockdown
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

면역원 서열

LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHF

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PRMT5(10419)

일반 설명

PRMT5 (protein arginine methyltransferase 5) belongs to the family of protein methyltransferases. It is a human homologue of Schizosaccaromyces pombe Skb1 (Shk1 kinase-binding protein 1), and Saccharomyces cerevisiae HSL7 (histone synthetic lethal 7) proteins. This gene is localized to the chromosome 14q11.2-21. It contains the motif characteristic of protein arginine methyltransferase (PRMT) family, which are S-adenosyl-L-methionine-dependent. This protein is a type II arginine methyltransferase. It is predominantly expressed in the cytoplasm.

면역원

Protein arginine N-methyltransferase 5 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-PRMT5 antibody is suitable for immunoprecipitation and ChIP (chromatin immunoprecipitation).
Anti-PRMT5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

PRMT5 (protein arginine methyltransferase 5) forms monomethylarginine or symmetrical dimethylarginine (MMA/sDMA) by methylating isolated arginine residues or arginine residues found in glycine- and arginine-rich (GAR) motifs. As it forms a part of various protein complexes, it plays essential roles in multiple cellular process. It regulates chromatin remodeling, leading to either gene activation or repression. Cell proliferation and survival is regulated by PRMT5, through extracellular signal-regulated kinase (ERK) pathway. It methylates CRAF (c-Rapidly Accelerated Fibrosarcoma) and BRAF (b-Rapidly Accelerated Fibrosarcoma), which in turn phosphorylate ERK protein. It methylates ribosomal protein S10 (RPS10) at the Arg (158) and Arg (160) residues. RPS10, in turn regulates the assembly of ribosomes, cell proliferation and protein synthesis. Therefore, PRMT5 is involved in tumorigenesis by regulating cell proliferation. PRMT5 is also associated with inflammation and related diseases, such as atherosclerosis, by regulating HOXA9, which has a pro-inflammatory function.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70548

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Yusuke Amano et al.
Pathology international, 68(6), 359-366 (2018-04-01)
Protein arginine methyltransferases (PRMT) 5, a member of type II arginine methyltransferases, catalyzes the symmetrical dimethylation of arginine residues on histone and non-histone substrates. Although the overexpression of PRMT5 has been reported in various cancers, its role in oral squamous
Pedro Andreu-Pérez et al.
Science signaling, 4(190), ra58-ra58 (2011-09-16)
The RAS to extracellular signal-regulated kinase (ERK) signal transduction cascade is crucial to cell proliferation, differentiation, and survival. Although numerous growth factors activate the RAS-ERK pathway, they can have different effects on the amplitude and duration of the ERK signal
Yun Teng et al.
Cancer research, 67(21), 10491-10500 (2007-11-03)
AS1411 is a quadruplex-forming oligonucleotide aptamer that targets nucleolin. It is currently in clinical trials as a treatment for various cancers. We have proposed that AS1411 inhibits cancer cell proliferation by affecting the activities of certain nucleolin-containing complexes. Here, we
Jinqi Ren et al.
The Journal of biological chemistry, 285(17), 12695-12705 (2010-02-18)
Modulation of ribosomal assembly is a fine tuning mechanism for cell number and organ size control. Many ribosomal proteins undergo post-translational modification, but their exact roles remain elusive. Here, we report that ribosomal protein s10 (RPS10) is a novel substrate
B P Pollack et al.
The Journal of biological chemistry, 274(44), 31531-31542 (1999-10-26)
To expand our understanding of the role of Jak2 in cellular signaling, we used the yeast two-hybrid system to identify Jak2-interacting proteins. One of the clones identified represents a human homologue of the Schizosaccaromyces pombe Shk1 kinase-binding protein 1, Skb1

Global Trade Item Number

SKUGTIN
HPA005525-100UL4061836319779
HPA005525-25UL4061842769117

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.