HPA005516

Anti-DDX20 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Component of gems 3, Anti-DEAD box protein 20, Anti-DEAD box protein DP 103, Anti-Gemin-3, Anti-Probable ATP-dependent RNA helicase DDX20
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA005516

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• 면역원 서열: MAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHGDH
• UniProt 수납 번호: Q9UHI6
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... DDX20(11218)

설명

일반 설명

DDX20 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 20) belongs to DExD/H-box family of proteins. This family is characterized by Asp-Glu-Ala-Asp/His motif present in their helicase domain. DDX20 is made of 824 amino acids. It is an RNA helicase and forms a part of the SMN (survival-of-motor-neurons) complex. The molecular weight of this protein is 103kDa. DDX20 has a hydrophobic N-terminal, and two hydrophilic regions in its C-terminal. In humans, its expression varies in accordance with the type of tissue, and shows a high level of expression in testis. During spermatogenesis in humans, DDX20 is localized to the chromtoid body structure in germ cells. This gene is located at human chromosome 1p21.1-p13.2.

면역원

Probable ATP-dependent RNA helicase DDX20 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-DDX20 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

DDX20 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 20) plays an essential role in early embryonic development, where it is involved in silencing of maternal transcripts and processing of RNA. It forms a core part of SMN (survival of motor neurons) complex, which is involved in the processing and assembly of RNPs (ribonucleoproteins), such as, snRNPs (spliceosomes), snoRNPs, miRNPs, hnRNPs and transcriptosomes. DDX20 plays a part in hind brain development where it suppresses the transcription of Egr2 (early growth response 2) gene. It regulates macrophage differentiation and proliferation, by silencing the expression of Ets target genes, involved in Ras pathway. It also acts as a cofactor in the SUMOylation of SF-1 (Steroidogenic factor 1) by PIASy (Protein inhibitor of activated STAT Y). This protein facilitates the assembly of the core of SMN complex, and this activity of DDX20 is associated with Spinal muscular atrophy (SMA). DDX20 acts as an oncogene that facilitates metastasis, in human breast cancer, and has potential as a therapeutic target for the same.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST86419

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)