추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
기술
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... THY1(7070)
일반 설명
Thy-1 (Thy-1 cell surface antigen) is a 18,000Da glycoprotein belonging to the immunoglobulin supergene family. It consists of a hydrophobic segment at the carboxyl terminus and a site for N-glycosylation.
Thy-1 cell surface antigen (Thy-1)/CD90 (cluster of differentiation 90) is a 25–37 kDa glycosylphosphatidylinositol (GPI)-anchored glycoprotein. It was first detected in the T cells of mice. Thy-1 is expressed in thymocytes, T cells, neurons, hematopoietic stem cells, cancer stem cells, endothelial cells and fibroblasts. This gene is located on human chromosome 11q23.
면역원
Thy-1 membrane glycoprotein precursor recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
생화학적/생리학적 작용
Thy-1 cell surface antigen (Thy-1)/CD90 (cluster of differentiation 90) is involved in T-cell activation, neuritis outgrowth modulation, vesicular release of neurotransmitter at the synapse, astrocyte adhesion, apoptosis in carcinoma cells, tumour suppression, wound healing, fibrosis and fibrogenesis. It also controls fibroblast focal adhesion, cytoskeleton organization and cell migration.
Thy-1 is also known as CD90 (Cluster of Differentiation 90). The gene is involved in invasion and associated with epithelial-mesenchymal transition. It is a novel diagnostic marker that contributes for the diagnosis of epithelioid mesothelioma. It can act as a promising novel prognostic marker for male breast cancer. It may act as a biomarker for several tumors as well as cancer stem cells and may be involved in the progression of hepatocellular carcinoma (HCC). It may also act as a potential marker of lung cancer stem cells.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST77497
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Caecilia Hapsari Ceriapuri Sukowati et al.
PloS one, 8(10), e76830-e76830 (2013-10-12)
Although the CD90 (Thy-1) was proposed as biomarker of several tumors and cancer stem cells, the involvement of this molecule in the progression of hepatocellular carcinoma (HCC) and other less frequent hepatic neoplasms is still undefined. The distribution of CD90
Xiuping Yan et al.
Oncology reports, 30(6), 2733-2740 (2013-10-09)
Accumulating evidence supports that cancer stem cells (CSCs) are responsible for tumor initiation, progression, distal metastasis and even drug resistance. Although CD90 has been identified as a marker for several types of stem cells, such as liver CSCs, the potential
Kiyoko Kawamura et al.
American journal of clinical pathology, 140(4), 544-549 (2013-09-21)
To pathologically distinguish mesothelioma from lung carcinoma, particularly adenocarcinoma. We conducted immunohistochemical analyses on clinical specimens, including 26 cases of mesothelioma, 28 cases of lung adenocarcinoma, and 33 cases of lung squamous cell carcinoma. We found that CD90 expression was
T Seki et al.
Proceedings of the National Academy of Sciences of the United States of America, 82(19), 6657-6661 (1985-10-01)
The human Thy-1 gene has been isolated and sequenced and compared to the rat and mouse Thy-1 genes. All three genes are organized in the same way: one exon encoding the majority of the signal peptide, another encoding the transmembrane
Ida Johansson et al.
PloS one, 8(10), e78299-e78299 (2013-11-07)
The rapidly growing collection of diverse genome-scale data from multiple tumor types sheds light on various aspects of the underlying tumor biology. With the objective to identify genes of importance for breast tumorigenesis in men and to enable comparisons with
문서
Mesenchymal stem cell markers and antibodies suitable for investigating targets in fibroblasts, chondrocytes, adipocytes, osteoblasts, and muscle cells.
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.