HPA002380

Anti-ABCC1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• 동의어(들): Anti-ATP-binding cassette sub-family C member 1, Anti-LTC4 transporter, Anti-Leukotriene C(4, Anti-Multidrug resistance-associated protein 1
• MDL number: MFCD01865488
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA002380
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 양식: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• 면역원 서열: LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD
• UniProt 수납 번호: P33527
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ABCC1(4363)

설명

일반 설명

ABCC1 (ATP binding cassette subfamily C member 1) is the members of the ATP-binding cassette (ABC) transporter superfamily. It is expressed in both endothelial cells and non-endothelia cells. Non-endothelial cells include pericytes, astrocytes, choroid plexus epithelia, ventricle ependymal cells, and neurons and larger blood vessels (mostly venules), microvasculature endothelial cells. Similar to other ABC transporters, ABCC1 also possess an additional membrane-spanning domain (MSD) with a putative extracellular, U-shaped amino terminus region.

면역원

Multidrug resistance-associated protein 1 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-ABCC1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

생화학적/생리학적 작용

The amino terminus end of ABCC1 (ATP binding cassette subfamily C member 1) serve as a regulating gate for the drug transport activity. Its activity is dependent on the ATP binding and hydrolysis. It plays a pivotal role in drug binding as well as drug and organic anion efflux across the plasma membrane. It mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-β-glucuronide, methotrexate, antiviral drugs and other xenobiotics. It may play an important role in adenosinergic/purinergic neuromodulation. It has a significant role in the regulation of dendritic cells (DCs) migration from peripheral tissues to lymph nodes by utilizing the leukotriene C(4) (LTC(4)) transporter. ABCC1 is associated with different neurodegenerative diseases (NDs), such as Alzheimer′s and Parkinson′s.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST86067

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable