콘텐츠로 건너뛰기
Merck
모든 사진(3)

문서

HPA001672

Sigma-Aldrich

Anti-SLC9A3R2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-NHE3 kinase A regulatory protein E3KARP antibody produced in rabbit, Anti-NHERF-2 antibody produced in rabbit, Anti-Na+/H+ exchange regulatory cofactor NHE-RF2 antibody produced in rabbit, Anti-SIP-1 antibody produced in rabbit, Anti-SRY-interacting protein 1 antibody produced in rabbit, Anti-Solute carrier family 9 isoform A3 regulatory factor 2 antibody produced in rabbit, Anti-TKA-1 antibody produced in rabbit, Anti-Tyrosine kinase activator protein 1 antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

형태

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunohistochemistry: 1:200- 1:500

면역원 서열

RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SLC9A3R2(9351)

면역원

Na+/H+ exchange regulatory cofactor NHE-RF2 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

SLC9A3R2 (solute carrier family 9, subfamily A, NHE3, cation proton antiporter 3, member 3 regulator 2) is a major adaptor protein involved in the anchoring of ion channels and receptors to the actin cytoskeleton via ERM (ezrin/radixin/moesin) protein interaction. It works as a Na+/H+ exchanger in the brush border membrane of the proximal tubule and small intestine. It plays a major role in the trans-epithelial Na+ absorption, which is regulated by cAMP (cyclic adenosine monophosphate). The protein consists of two PSD-95/Dlg/ZO-1 (PDZ) domains, which bind the PDZ docking motif (X-(S/T)-X-(V/L)) of proteins to allow the assembly of transmembrane and cytoplasmic proteins into active signal transduction complexes. In SGK1 (serum and glucocorticoid induced protein kinase 1) activation mechanism, it helps to activate and phosphorylate SGK1 by 3-phosphoinositide-dependent protein kinase 1 (PDK1) through its PDZ domain and PIF (PDK1 interacting fragment) motif.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST85045

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our 제품 선택기 도구.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Shin-ichi Terawaki et al.
Structure (London, England : 1993), 14(4), 777-789 (2006-04-18)
The Na+/H+ exchanger regulatory factor (NHERF) is a key adaptor protein involved in the anchoring of ion channels and receptors to the actin cytoskeleton through binding to ERM (ezrin/radixin/moesin) proteins. NHERF binds the FERM domain of ERM proteins, although NHERF
C H Yun et al.
The Journal of biological chemistry, 273(40), 25856-25863 (1998-09-25)
Cyclic AMP is a major second messenger that inhibits the brush border Na+/H+ exchanger NHE3. We have previously shown that either of two related regulatory proteins, E3KARP or NHERF, is necessary for the cAMP-dependent inhibition of NHE3. In the present
Jaesun Chun et al.
Biochemical and biophysical research communications, 298(2), 207-215 (2002-10-22)
The Na(+)/H(+) exchanger regulatory factor 2 (NHERF2/TKA-1/E3KARP) contains two PSD-95/Dlg/ZO-1 (PDZ) domains which interact with the PDZ docking motif (X-(S/T)-X-(V/L)) of proteins to mediate the assembly of transmembrane and cytosolic proteins into functional signal transduction complexes. One of the PDZ
Michihiro Yoshida et al.
American journal of physiology. Gastrointestinal and liver physiology, 310(8), G586-G598 (2016-02-13)
The Na(+)/H(+) exchanger regulatory factor (NHERF) family of proteins is scaffolds that orchestrate interaction of receptors and cellular proteins. Previous studies have shown that NHERF1 functions as a tumor suppressor. The goal of this study is to determine whether the
Christian Vogl et al.
EMBO reports, 18(11), 2015-2029 (2017-09-13)
Lipopolysaccharide-responsive beige-like anchor protein (LRBA) belongs to the enigmatic class of BEACH domain-containing proteins, which have been attributed various cellular functions, typically involving intracellular protein and membrane transport processes. Here, we show that LRBA deficiency in mice leads to progressive

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.