콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

HPA001429

Sigma-Aldrich

Anti-NBN antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Cell cycle regulatory protein p95, Anti-Nibrin, Anti-Nijmegen breakage syndrome protein 1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

면역원 서열

DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... NBN(4683)

일반 설명

NBN (nibrin) is a part of a highly conserved protein complex, which also includes MRE11 and RAD50 proteins. This complex is essential in recognition and signaling of DNA double-strand break (DSB). Functionally, this protein can be divided into two domains- C-terminal contains MRE11 (meiotic recombination 11 homolog A)- and ATM (ataxia telangiectasia-mutated) kinase-binding domains. Its N-terminal is responsible for phosphor-dependent protein-protein interactions and contains forkhead-associated (FHA) and breast cancer C-terminal (BRCT).

면역원

Nibrin recombinant protein epitope signature tag (PrEST)

애플리케이션

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

생화학적/생리학적 작용

NBN (nibrin) is involved in DNA double-strand break repair. It activates DNA damage-induced checkpoint. Defects in this gene are associated with Nijmegen breakage syndrome that is characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. It plays a role in tumorigenesis, and this gene is mutated in breast and colorectal cancer, primary glioblastoms and medulloblastoma, acute lymphoblastic leukemia (ALL) and other lymphoid malignancies.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST78218

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Philipp Seidel et al.
Oncotarget, 7(17), 23006-23018 (2016-04-07)
Nijmegen Breakage Syndrome is a disease caused by NBN mutations. Here, we report a novel function of Nbn in skin homeostasis. We found that Nbn deficiency in hair follicle (HF) progenitors promoted increased DNA damage signaling, stimulating p16Ink4a up-regulation, Trp53
Naoyuki Hayashi et al.
Journal of biochemistry, 154(5), 429-435 (2013-08-07)
NBS1 is the causative gene product of Nijmegen breakage syndrome (NBS), a recessive genetic disorder resulting in chromosomal instability and immunodeficiency. We isolated DNMT1 cDNA by two-hybrid screening by using NBS1 as bait to study its function in DNA replication
Regina Waltes et al.
American journal of human genetics, 84(5), 605-616 (2009-05-05)
The MRE11/RAD50/NBN (MRN) complex plays a key role in recognizing and signaling DNA double-strand breaks (DSBs). Hypomorphic mutations in NBN (previously known as NBS1) and MRE11A give rise to the autosomal-recessive diseases Nijmegen breakage syndrome (NBS) and ataxia-telangiectasia-like disorder (ATLD)
Yan Wang et al.
PloS one, 8(12), e82426-e82426 (2013-12-19)
Nijmegen breakage syndrome (NBS) with NBS1 germ-line mutation is a human autosomal recessive disease characterized by genomic instability and enhanced cancer predisposition. The NBS1 gene codes for a protein, Nbs1(p95/Nibrin), involved in the processing/repair of DNA double-strand breaks. Hepatocellular carcinoma
Yuki Yamamoto et al.
Cancer research, 74(14), 3707-3715 (2014-05-17)
Failure to expeditiously repair DNA at sites of double-strand breaks (DSB) ultimately is an important etiologic factor in cancer development. NBS1 plays an important role in the cellular response to DSB damage. A rare polymorphic variant of NBS1 that resulted

Global Trade Item Number

SKUGTIN
HPA001429-100UL4061837132780
HPA001429-25UL4061842772858

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.