콘텐츠로 건너뛰기
Merck
모든 사진(6)

문서

HPA001238

Sigma-Aldrich

Anti-MMP9 antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

CLG4B

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
인간 단백질 도해서 번호:

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

형태

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

UniProt 수납 번호

응용 분야

research pathology

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... MMP9(4318)

일반 설명

Matrix metalloproteinase-9 (MMP-9) is a pro-inflammatory, zinc-dependent proteinase, which is also known as 92kDa gelatinase. It is secreted by granulocytes and mononuclear cells. The activity of MMP-9 is controlled by gene transcription. The gene encoding it is localized on human chromosome 20q11.2-q13.1 and has 13 exons.

면역원

Recombinant protein corresponding to Matrix metalloproteinase-9

Sequence
PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MMP9 antibody produced in rabbit has been used in:
  • immunohistochemistry
  • western blotting
  • fluorescence immunohistochemistry

생화학적/생리학적 작용

Matrix metalloproteinase-9 (MMP-9) catalyzes the degradation of gelatin and collagen. It has been studied as a biomarker for inflammation in multiple sclerosis (MS). The MMP9 protein is a zinc-dependent protease which is responsible for degradation of extracellular matrix components. It also participates in the pathogenesis of cancers.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST83039

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our 제품 선택기 도구.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Julie A Bass et al.
BMC gastroenterology, 15, 129-129 (2015-10-16)
Early manifestations of pediatric inflammatory bowel disease (IBD) can be relatively nonspecific. Initial mucosal biopsies may not be conclusive, delaying the diagnosis until subsequent biopsies demonstrate typical histologic features of IBD. We hypothesized that certain inflammatory cell types may be
Miconazole protects blood vessels from MMP9-dependent rupture and hemorrhage.
Yang R, et al.
Disease models & mechanisms, 10(3), 337-348 (2017)
Matrix metalloproteinases: old dogs with new tricks.
Somerville RP, et al.
Genome Biology, 4(6), 216-216 (2003)
David G P van IJzendoorn et al.
Clinical cancer research : an official journal of the American Association for Cancer Research (2022-08-26)
A major component of cells in Tenosynovial Giant Cell Tumor (TGCT) consists of bystander macrophages responding to CSF1 that is overproduced by a small number of neoplastic cells with a chromosomal translocation involving the CSF1 gene. An autocrine loop was
Association between four MMP-9 polymorphisms and breast cancer risk: a meta-analysis.
Zhang X, et al.
Medical Science Monitor : International Medical Journal of Experimental and Clinical Research, 21(16), 1115-1115 (2015)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.