추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
RNAi knockdown
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... STX17(55014)
일반 설명
Syntaxin 17 (Stx17) is an autophagosomal SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein. STX17 is a member of the syntaxin family and is located on human chromosome 9q31. It is stored in the cytosol.
면역원
Syntaxin-17 recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-STX17 antibody has been used:
- in SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein reconstitution
- in immunoelectron microscopy
- to investigate its relevance to the hepatitis C virus (HCV) life cycle and, thereby, to reveal the role of autophagosome-lysosome fusion for the turnover of viral particles
Anti-STX17 antibody produced in rabbit is suitable for co-immunoprecipitation.
Anti-STX17 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Anti-STX17 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
생화학적/생리학적 작용
Syntaxin 17 (STX17) is an autophagosomal SNARE (soluble N-ethylmaleimide–sensitive factor attachment protein receptors) that in involved in fusion with the endosome/lysosome. It is mostly localized to the ER and to some extent in the ER-Golgi intermediate compartment (ERGIC). It may function as a receptor at the ER membrane that is involved in the trafficking between the ER and post-ER compartments. It cycles between ER and ERGIC via pathways involving COPII and COPI (coatomer protein I) vesicle. The protein is required for the maintenance of ERGIC and Golgi architecture.
Syntaxin 17 (Stx17) encodes membrane proteins, that participates in synaptic vesicle fusion.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST79900
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Bio-protocol, 7(17), 27982478-27982478 (2017-10-03)
Autophagy is a recycling pathway, in which intracellular cargoes including protein aggregates and bacteria are engulfed by autophagosomes and subsequently degraded after fusion with lysosomes. Dysregulation of this process is involved in several human diseases such as cancer or neurodegeneration.
Journal of virology, 90(13), 5989-6000 (2016-04-22)
Syntaxin 17 is an autophagosomal SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein required for the fusion of autophagosomes with lysosomes to form autolysosomes and thereby to deliver the enclosed contents for degradation. Hepatitis C virus (HCV) induces autophagy. In
LAMP-2 is required for incorporating syntaxin-17 into autophagosomes and for their fusion with lysosomes
Biology Open, bio-018648 (2016)
The autophagosomal SNARE protein syntaxin 17 is an essential factor for the hepatitis C virus life cycle
Journal of Virology, 520(7548), JVI-00551 (2016)
The autophagosomal SNARE protein syntaxin 17 is an essential factor for the hepatitis C virus life cycle
Journal of virology, JVI-00551 (2016)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.