콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV54366

Sigma-Aldrich

Anti-IMPDH2 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-IMP (inosine monophosphate) dehydrogenase 2, Anti-IMPD2, Anti-IMPDH-II

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

56 kDa

종 반응성

guinea pig, rabbit, bovine, horse, mouse, rat, human, dog

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... IMPDH2(3615)

면역원

Synthetic peptide directed towards the C terminal region of human IMPDH2

애플리케이션

Anti-IMPDH2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

생화학적/생리학적 작용

IMPDH2 gene encodes the rate-limiting enzyme inosine monophosphate dehydrogenase 2. It consists of 14 exons and is approximately 5.8kb in length. It is localised in the cytoplasm and nucleus. It plays a pivotal role in catalysing the NAD-dependent oxidation of inosine-5′-monophosphate into xanthine-5′-monophosphate, later converted to guanosine-5′-monophosphate. A novel non-genotoxic p53 activator Inauzhin (INZ) inhibits cellular activity of IMPDH2, which in turn reduces the levels of cellular GTP and GTP-binding nucleostemin. INZ also induces the ribosomal stress (RS)-p53 pathway and RPL11/RPL5-MDM2 interaction and activates p53 and inhibits cancer cell growth.

서열

Synthetic peptide located within the following region: SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Qi Zhang et al.
eLife, 3, doi:10-doi:10 (2014-10-28)
The 'ribosomal stress (RS)-p53 pathway' is triggered by any stressor or genetic alteration that disrupts ribosomal biogenesis, and mediated by several ribosomal proteins (RPs), such as RPL11 and RPL5, which inhibit MDM2 and activate p53. Inosine monophosphate (IMP) dehydrogenase 2
Jeremy E McLean et al.
The Biochemical journal, 379(Pt 2), 243-251 (2004-02-10)
Inosine 5'-monophosphate dehydrogenase (IMPDH) is the rate-limiting enzyme in the de novo biosynthesis of guanine nucleotides. In addition to the catalytic domain, IMPDH contains a subdomain of unknown function composed of two cystathione beta-synthase domains. Our results, using three different
A G Zimmermann et al.
The Journal of biological chemistry, 270(12), 6808-6814 (1995-03-24)
Inosine-5'-monophosphate dehydrogenase (IMPDH) activity and mRNA levels are induced up to 15-fold upon mitogenic or antigenic stimulation of human peripheral blood T lymphocytes. This increase in IMPDH activity is required for cellular proliferation and has been associated with malignant transformation.
L Zhou et al.
Clinical & translational oncology : official publication of the Federation of Spanish Oncology Societies and of the National Cancer Institute of Mexico, 16(10), 906-913 (2014-03-25)
Our previous study showed the upregulation of inosine 5'-monophosphate dehydrogenase type II (IMPDH2) protein in human prostate cancer (PCa) tissues and sera compared to non-cancerous controls by proteomics and ELISA analyses. However, the clinical significance of IMPDH2 in PCa has

문서

Neoplastic cells are highly dependent on the de novo synthesis of nucleotides to maintain sufficient pools to support DNA replication and the production of RNA.

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.