추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
17 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... IL1B(3553)
일반 설명
Interleukin-1β (IL1β) is produced by activated macrophages. It is synthesized as pro-IL-1β which is changed to active form IL-1β with the help of pro-inflammatory protease caspase-1. IL-1β belongs to the IL-1 gene family. It is a proinflammatory cytokine. The gene is mapped to human chromosome 2q14.
면역원
Synthetic peptide directed towards the N terminal region of human IL1B
애플리케이션
Anti-IL1B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
생화학적/생리학적 작용
Interleukins are proinflammatory cytokines produced on cell injury or trauma. There are two closely related types of interleukins produced by the cell, IL-1α and IL-1β that are produced by the activation of NF-κB transcription factor in response to bacterial infection or LPS. Both IL-1α and IL-1β exert their cellular effects by signalling through IL-1 receptor type 1. IL-1β has pleiotropic activities and is protective against infections by recruitment of neutrophils to the infection site, secretion of cytokines and chemokines and activation of adhesion molecules. IL-1β overproduction has been implicated in many auto-immune and allergic disorders such as Cryopirin-associated periodic syndromes, Muckle-Wells syndrome and skin lesions.
서열
Synthetic peptide located within the following region: DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Manoranjan Sahoo et al.
TheScientificWorldJournal, 11, 2037-2050 (2011-11-30)
The inflammasome is an important innate immune pathway that regulates at least two host responses protective against infections: (1) secretion of the proinflammatory cytokines IL-1β and IL-18 and (2) induction of pyroptosis, a form of cell death. Inflammasomes, of which
P C M van Poppel et al.
Diabetes, obesity & metabolism, 16(12), 1269-1273 (2014-07-22)
Inflammation at the level of the β cell appears to be involved in progressive β-cell dysfunction in type 2 diabetes. We assessed the effect of blocking interleukin-1 (IL-1) by anakinra [recombinant human interleukin-1 receptor antagonist (IL-1Ra)] on β-cell function. Sixteen
Charles A Dinarello
Current opinion in pharmacology, 4(4), 378-385 (2004-07-15)
All biological agents currently used for reducing TNFalpha activity in disease are neutralization strategies; however, there are several strategies for reducing interleukin (IL)-1 activities: the IL-1 receptor antagonist (IL-1Ra), anti-IL-1beta monoclonal antibodies, the IL-1 Trap, IL-1 receptor type I antibodies
Axel Weber et al.
Science signaling, 3(105), cm1-cm1 (2010-01-21)
The interleukin-1 (IL-1) family of cytokines comprises 11 proteins (IL-1F1 to IL-1F11) encoded by 11 distinct genes in humans and mice. IL-1-type cytokines are major mediators of innate immune reactions, and blockade of the founding members IL-1alpha or IL-1beta by
Emmanuel Contassot et al.
Swiss medical weekly, 142, w13590-w13590 (2012-06-02)
Interleukin 1, one of the first cytokines discovered in the 1980s, and a potent mediator of fever, pain and inflammation, is at present experiencing a revival in biology and medicine. Whereas the mechanism of activation and secretion of interleukin 1β
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.