추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
98 kDa
종 반응성
horse, human, rabbit, bovine, rat
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... NUP98(4928)
일반 설명
Nuclear pore complex protein is a protein encoded by the nucleoporin 98 kDa (NUP98) gene in humans. NUP98 gene encodes a peripheral membrane protein nucleoporin that belongs to nucleoporin GLFG family. This protein is formed from a precursor protein of 186 kDa that after cleavage yields two nucleoporins, Nup96 and Nup98. The nuclear import and export takes place through the nuclear pore complex (NPC), which is composed of unique proteins known as nucleoporins. The NUP98 gene of 122kb long, has 33 exons and is located on human chromosome 11p15.4.
면역원
Synthetic peptide directed towards the N terminal region of human NUP98
애플리케이션
Anti-NUP98 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
생화학적/생리학적 작용
Nucleoporin 98 kDa (NUP98) functions as a docking protein for cytosol mediated docking of import substrates. During mitosis, NUP98 interacts with nucleocytoplasmic transport factors Rae1 and regulates the destruction of the securin protein by the anaphase-promoting complex (APC). Thus, Nucleoporins play an important function in nucleocytoplasmic transport, transcription and mitosis. Nuclear pore complex (NPC) also plays a role during nuclear processes such as chromatin silencing, transcriptional regulation and DNA damage repair. NUP98-Rae1 complex prevents aneuploidy. Overexpression of NUP98 along with other proteins and several associated nuclear export factors dysregulate signaling pathways and transcription resulting in alteration of nucleoporin functionality, which may cause cancer. NUP98 acts as an important predictor of anthracycline-based chemotherapy response in triple-negative breast cancer patients.
서열
Synthetic peptide located within the following region: EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Advances in experimental medicine and biology, 773, 285-307 (2014-02-25)
The nuclear pore complex (NPC) mediates trafficking between the cytoplasm and nucleoplasm. It also plays key roles in other nuclear processes such as chromatin silencing, transcriptional regulation, and DNA damage repair. Nucleoporins, the structural components of the NPC, have been
BMC cancer, 19(1), 236-236 (2019-04-03)
Triple Negative breast cancer (TNBC) is a poor outcome subgroup of breast cancer defined based on the absence of expression of ERα and PR and HER2 amplification. These hard to treat cancers lack targeted treatment options and are therefore treated
Leukemia, 20(4), 696-706 (2006-02-10)
The NUP98 gene is fused with 19 different partner genes in various human hematopoietic malignancies. In order to gain additional clinico-hematological data and to identify new partners of NUP98, the Groupe Francophone de Cytogénétique Hématologique (GFCH) collected cases of hematological
Seminars in cancer biology, 27, 3-10 (2014-03-25)
Hematologic malignancies are often associated with chromosomal rearrangements that lead to the expression of chimeric fusion proteins. Rearrangements of the genes encoding two nucleoporins, NUP98 and NUP214, have been implicated in the pathogenesis of several types of hematologic malignancies, particularly
Blood, 89(11), 3936-3944 (1997-06-01)
The inv(11)(p15q22) is a recurrent chromosomal abnormality associated with de novo and therapy-related myeloid malignancies. Here we report the molecular definition of this chromosomal aberration in four patients. Positional cloning showed the consistent rearrangement of the DDX10 gene on chromosome
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.