AV52402

Anti-EGLN3 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Egl nine homolog 3 (C. elegans), Anti-FLJ21620, Anti-HIFPH3, Anti-MGC125998, Anti-MGC125999, Anti-PHD3
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 27 kDa
• 종 반응성: rat, human, horse, rabbit, bovine, dog, mouse, guinea pig
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_071356
• UniProt 수납 번호: Q9H6Z9
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... EGLN3(112399)

설명

면역원

Synthetic peptide directed towards the C terminal region of human EGLN3

생화학적/생리학적 작용

EGLN3 catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates HIF-1 alpha at ′Pro-564′, and HIF-2 alpha. EGLN3 functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. It may play a role in cell growth regulation in muscle cells and in apoptosis in neuronal tissue. EGLN3 promotes cell death through a caspase-dependent mechanism.

서열

Synthetic peptide located within the following region: FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable