추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
74 kDa
종 반응성
dog, human, horse, guinea pig, bovine, rat, mouse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... JPH2(57158)
면역원
Synthetic peptide directed towards the middle region of human JPH2
애플리케이션
Anti-JPH2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
생화학적/생리학적 작용
Junctophilin 2 (JPH2; CMH17) is a member of the junctophilin family. The members of this family form the junctional complexes present between the plasma membrane and the endoplasmic/sarcoplasmic reticululm. JPH2 couples the sarcolemmal and the intracellular calcium channels in the skeletal and cardiac muscle. The expression of JPH2 is essential for the formation of postnatal T-tubule in mammals. Dysregulation of junctophilins result in a variety of cardiac disorders.
서열
Synthetic peptide located within the following region: ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Andrew P Landstrom et al.
Trends in molecular medicine, 20(6), 353-362 (2014-03-19)
Excitable tissues rely on junctional membrane complexes to couple cell surface signals to intracellular channels. The junctophilins have emerged as a family of proteins critical in coordinating the maturation and maintenance of this cellular ultrastructure. Within skeletal and cardiac muscle
David L Beavers et al.
Cardiovascular research, 103(2), 198-205 (2014-06-18)
Cardiomyocytes rely on a highly specialized subcellular architecture to maintain normal cardiac function. In a little over a decade, junctophilin-2 (JPH2) has become recognized as a cardiac structural protein critical in forming junctional membrane complexes (JMCs), which are subcellular domains
Yoshihisa Matsushita et al.
Journal of human genetics, 52(6), 543-548 (2007-05-04)
Junctophilin subtypes, designated as JPH1 approximately 4, are protein components of junctional complexes and play essential roles in cellular Ca2+ signaling in excitable cells. Knockout mice lacking the cardiac-type Jph2 die of embryonic cardiac arrest, and the mutant cardiac myocytes
Alejandro Garbino et al.
Physiological genomics, 37(3), 175-186 (2009-03-26)
Junctophilins (JPHs) are members of a junctional membrane complex protein family important for the physical approximation of plasmalemmal and sarcoplasmic/endoplasmic reticulum membranes. As such, JPHs facilitate signal transduction in excitable cells between plasmalemmal voltage-gated calcium channels and intracellular calcium release
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.