추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
54 kDa
종 반응성
dog, human, rat, mouse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PLXDC1(57125)
면역원
Synthetic peptide directed towards the N terminal region of human PLXDC1
애플리케이션
Anti-PLXDC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
생화학적/생리학적 작용
Plexin domain containing 1 (PLXDC1; tumor endothelial marker 7, TEM7) is a transmembrane and secreted protein containing plexin-like and weak nidogen-like domains. It mediates protein-protein interactions and is associated with angiogenic state of these cells. It is highly expressed in endothelium of tumor cells in a variety of cancer types.
서열
Synthetic peptide located within the following region: MDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHT
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Judy R van Beijnum et al.
Frontiers in bioscience (Scholar edition), 1, 216-225 (2009-06-02)
Endothelial cells (EC) are attractive targets for therapeutic interference in diseases that are dependent on the formation of novel blood vessels, such as cancer. EC are readily accessible via the blood stream and are considered to be genetically stable, thus
Rebecca G Bagley et al.
Microvascular research, 82(3), 253-262 (2011-10-01)
Antiangiogenesis has been validated as a therapeutic strategy to treat cancer, however, a need remains to identify new targets and therapies for specific diseases and to improve clinical benefit from antiangiogenic agents. Tumor endothelial marker 7 (TEM-7) was investigated as
Akash Nanda et al.
Cancer research, 64(23), 8507-8511 (2004-12-03)
Tumor endothelial marker 7 (TEM7) was recently identified as an mRNA transcript overexpressed in the blood vessels of human solid tumors. Here, we identify several new variants of TEM7, derived by alternative splicing, that are predicted to be intracellular (TEM7-I)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.