추천 제품
![N-[[2-(Diphenylphosphino)phenyl]methylene]-3-methyl-L-valine sodium salt 95%](/deepweb/assets/sigmaaldrich/product/structures/514/394/34f4fd07-0745-48d5-b150-23701865e8a1/640/34f4fd07-0745-48d5-b150-23701865e8a1.png)
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
24 kDa
종 반응성
mouse, pig, bovine, human, dog, rabbit, horse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... GSTZ1(2954)
면역원
Synthetic peptide directed towards the N terminal region of human GSTZ1
애플리케이션
Anti-GSTZ1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
생화학적/생리학적 작용
Glutathione S-transferase zeta 1 (GSTZ1) belongs to glutathione S-transferase (GSTs) super-family involved in detoxification of carcinogens and drugs by conjugation with glutathione. GSTZ1 is also involved in the metabolism of phenylalanine and tyrosine. Defects in GSTZ1 gene result in metabolic disorders such as phenylketonuria, alkaptonuria and tyrosinaemia.
서열
Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Li Yin et al.
Journal of molecular recognition : JMR, 26(1), 38-45 (2013-01-03)
Accumulating evidence shows that glutathione peroxidase (GPX, EC.1.11.1.9), one of the most important antioxidant selenoenzymes, plays an essential role in protecting cells and tissues against oxidative damage by catalyzing the reduction of hydrogen peroxide by glutathione. Unfortunately, because of the
G Polekhina et al.
Biochemistry, 40(6), 1567-1576 (2001-05-01)
Maleylacetoacetate isomerase (MAAI), a key enzyme in the metabolic degradation of phenylalanine and tyrosine, catalyzes the glutathione-dependent isomerization of maleylacetoacetate to fumarylacetoacetate. Deficiencies in enzymes along the degradation pathway lead to serious diseases including phenylketonuria, alkaptonuria, and the fatal disease
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.