추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
분자량
24 kDa
종 반응성
bovine, rat, mouse, goat, dog, human, guinea pig
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... RAB11B(9230)
관련 카테고리
일반 설명
RAB11B is a GTP-binding protein that regulates diverse cellular functions.It is expressed in vesicular compartments in parietal and epithelial cells. Neuronal Rab11b has been implicated in exocytosis.
Rabbit Anti-RAB11B antibody recognizes zebrafish, human, mouse, rat, canine, chicken, and bovine RAB11B.
Rabbit Anti-RAB11B antibody recognizes zebrafish, human, mouse, rat, canine, chicken, and bovine RAB11B.
면역원
Synthetic peptide directed towards the C terminal region of human RAB11B
애플리케이션
Rabbit Anti-RAB11B antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.
생화학적/생리학적 작용
RAB11B possesses GTPase activity.
서열
Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Lynne A Lapierre et al.
Experimental cell research, 290(2), 322-331 (2003-10-22)
The Rab11 family of small GTPases is composed of three members, Rab11a, Rab11b, and Rab25. While recent work on Rab11a and Rab25 has yielded some insights into their function, Rab11b has received little attention. Therefore, we sought to examine the
Mikhail V Khvotchev et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 23(33), 10531-10539 (2003-11-25)
Using PC12 cells that express transfected human growth hormone (hGH) as a secreted reporter protein, we have searched for Rab proteins that function in exocytosis. Among the Rab proteins tested, we found that besides the previously described Rab3 proteins, only
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.