추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
43 kDa
종 반응성
bovine, mouse, rabbit, rat, pig, human, sheep
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SERPINE1(5054)
일반 설명
SerPINE1 is a serine proteinase inhibitor that blocks fibrinolysis by inhibiting tissue plasminogen activator (tPA) and urokinase (uPA). Genetic variations in SERPINE1 have been linked to pre-eclampsia (PE). Studies have reported that targeting SERPINE1 (PAI-1) expression in Alzheimer′s disease may have therapeutic implications. Moreover, MiR-34c regulates SERPINE1 expression in emphysema.
Rabbit Anti-SerPINE1 antibody recognizes pig, human, mouse, rat, and bovine SERPINE1.
Rabbit Anti-SerPINE1 antibody recognizes pig, human, mouse, rat, and bovine SERPINE1.
면역원
Synthetic peptide directed towards the N terminal region of human SERPINE1
애플리케이션
Rabbit Anti-SerPINE1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.
생화학적/생리학적 작용
SERPINE1 acts as ′bait′ for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
서열
Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Stacie M Kutz et al.
Molecular Medicine & Therapeutics, 1(2), 106-106 (2013-07-13)
Accumulation of neurotoxic amyloid peptides (Aβ) in the brain, generated by β-site proteolytic processing of the amyloid precursor protein (APP), is the hallmark pathophysiologic feature of Alzheimer's disease. The plasmin-activating cascade, in which urokinase (uPA) and tissue-type (tPA) plasminogen activators
Santiyagu M Savarimuthu Francis et al.
BMC genomics, 15, 88-88 (2014-02-01)
MicroRNAs (MiRNA) are small non-coding RNAs that regulate gene expression. The aim of this study was to identify miRNAs differentially expressed between mild and moderately emphysematous lung, as well as their functional target mRNAs. Resected lung from patients with COPD
Linlu Zhao et al.
Molecular human reproduction, 19(3), 136-143 (2012-11-28)
The SERPINE1 -675 4G/5G promoter region insertion/deletion polymorphism (rs1799889) has been implicated in the pathogenesis of pre-eclampsia (PE), but the genetic association has been inconsistently replicated. To derive a more precise estimate of the association, a systematic review and meta-analysis
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.