추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
51 kDa
종 반응성
human, rat, pig, horse, mouse, bovine, dog
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... RTN2(6253)
관련 카테고리
면역원
Synthetic peptide directed towards the N terminal region of human RTN2
애플리케이션
Anti-RTN2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.
생화학적/생리학적 작용
RTN2 (reticulon 2) gene also referred to as NSP2 or NSPL1 is a member of reticulon encoding gene family. It plays a pivotal role in organizing endoplasmic reticulum and distal motor axons. RTN2B, isoform of RTN2 regulates the trafficking as well as facilitates as a positive modulator for delivering the EAAC1 (excitatory amino acid carrier 1) from ER to the cell surface. Mutation in RTN2 gene leads to axon-degenerative disorder hereditary spastic paraplegia type 12.
서열
Synthetic peptide located within the following region: MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Yiting Liu et al.
The Journal of biological chemistry, 283(10), 6561-6571 (2007-12-22)
Excitatory amino acid transporters (EAATs) are the primary regulators of extracellular glutamate concentrations in the central nervous system. Their dysfunction may contribute to several neurological diseases. To date, five distinct mammalian glutamate transporters have been cloned. In brain, EAAC1 (excitatory
Gladys Montenegro et al.
The Journal of clinical investigation, 122(2), 538-544 (2012-01-11)
Hereditary spastic paraplegias (HSPs) are a group of genetically heterogeneous neurodegenerative conditions. They are characterized by progressive spastic paralysis of the legs as a result of selective, length-dependent degeneration of the axons of the corticospinal tract. Mutations in 3 genes
Niamh C O'Sullivan et al.
Human molecular genetics, 21(15), 3356-3365 (2012-05-01)
Several causative genes for hereditary spastic paraplegia encode proteins with intramembrane hairpin loops that contribute to the curvature of the endoplasmic reticulum (ER), but the relevance of this function to axonal degeneration is not understood. One of these genes is
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.