추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
46 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TMPRSS11D(9407)
면역원
Synthetic peptide directed towards the N terminal region of human TMPRSS11D
애플리케이션
Anti-TMPRSS11D antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.
생화학적/생리학적 작용
TMPRSS11D (transmembrane protease, serine 11D) gene also referred to as MGC150587, MGC150588 or HAT(human airway trypsin-like protease) encodes for a 418 amino acid containing type II integral membrane protein. HAT stimulates amphiregulin (AR) production via protease-activated receptor-2 (PAR-2) mediated ERK pathway and then releases it by TACE (tumor necrosis factor alpha-converting enzyme)-dependent mechanism. HAT also activates the PAR-2 and assists in regulating the cellular functions of human bronchial epithelial cells (HBEC). Additionally, it induces the fibroblast proliferation in bronchial airways by mediating the PAR-2-dependent MEK-MAPK pathway.
서열
Synthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Rie Matsushima et al.
American journal of physiology. Lung cellular and molecular physiology, 290(2), L385-L395 (2005-10-04)
Human airway trypsin-like protease (HAT) was isolated from airway secretions and localized to bronchial epithelial cells by immunohistochemistry. In the present study, we examined whether HAT could stimulate DNA synthesis and proliferation of primary human bronchial fibroblasts (HBF). HAT significantly
Manabu Chokki et al.
The FEBS journal, 272(24), 6387-6399 (2005-12-13)
Human airway trypsin-like protease (HAT), a serine protease found in the sputum of patients with chronic airway diseases, is an agonist of protease-activated receptor-2 (PAR-2). Previous results have shown that HAT enhances the release of amphiregulin (AR); further, it causes
Mari Miki et al.
The journal of medical investigation : JMI, 50(1-2), 95-107 (2003-03-13)
It has been shown that human airway trypsin-like protease (HAT) is localized in human bronchial epithelial cells (HBEC), and trypsin activates protease-activated receptor-2 (PAR-2). Activation of PAR-2 activates G-protein followed by an increase of intracellular free Ca2+, [Ca2+]in. This study
Jee Hyun Kim et al.
Yonsei medical journal, 55(5), 1333-1340 (2014-07-23)
The aim of this work was to evaluate nuclear histone acetylation level and total histone acetyltransferase (HAT) and deacetylase (HDAC) activity in ejaculated sperm and their relevance to conventional sperm parameters. Thirty-three normozoospermic men were included in this study. Semen
F Wang et al.
Neurological research, 36(3), 224-233 (2014-02-12)
The herbal extract 3-n-butylphthalide (NBP) is used in clinical practice for ischemic patients in China. It has been shown to have various neuroprotective effects both in vitro and in vivo. In the present study, the effects of NBP on learning
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.